GlycoProtDB ID - GPDB0005318


Protein Name Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
Protein Accession Number Q5JCT0
Gene Gcnt3
Length 437
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MTSWQRLCWH YRLWTLGCYM LLAILALKLS LRLKCDFDAM DLDSEEFQSQ YCRDLLYKTL KLPAKSSINC SGVIRGEQKA VTQALLNNLE IKKKQQLFTE
ADYLRMTADC EHFKTKRKFI QVPLSKEEAS FPIAYSMVVH EKIENFERLL RAVYTPQNVY CVHMDQKSSE PFKQAVRAIV SCFPNVFIAS KLVSVVYASW
SRVQADLNCM EDLLQSPVPW KYLLNTCGTD FPIKTNAEMV KALKLLKGQN SMESEVPPPH KKSRWKYHYE VTDTLHMTSK RKTPPPNNLT MFTGNAYMVA
SRDFIEHVFS NSKARQLIEW VKDTYSPDEH LWATLQRASW MPGSDPLHRK FDLSDMRAIA RLTKWYDHEG DIENGAPYTS CSGIHQRAVC VYGSGDLHWI
LQNHHLLANK FDPKVDDNVL QCLEEYLRHK AIYGTEL

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
69 NCS 66 - 75
SSINCSGVIR
Unique
66 - 79
SSINCSGVIRGEQK
Unique
225 NTC
288 NLT 282 - 302
KTPPPNNLTMFTGNAYMVASR
Unique
283 - 313
TPPPNNLTMFTGNAYMVASRDFIEHVFSNSK
Unique
283 - 302
TPPPNNLTMFTGNAYMVASR
Unique
Colon Skeletal_muscle Stomach
Amide80 ConA RCA120 Amide80 ConA Amide80 ConA RCA120
     
               
             
             
       
   
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05