GlycoProtDB ID - GPDB0005371


Protein Name CUB domain-containing protein 1
Protein Accession Number Q5U462
Gene Cdcp1
Length 833
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
MAHSACGFSV ALLGALLLGT ARLLRGTEAS EIALPQRSGV TVSIKLGNPA LPVKICYIVM SRQHITELII RPGERKSFTF SCSNPEKHFV LKIEKNIDCM
SGPCPFGEVH LQPSTSELPI LNRTFIWDVR AHKSIGLELQ FATPRLRQIG PGESCADGVT HSISGHIDAT EVRIGTFCSN GTVSRIKMQE GVKMALHLPW
FHRRNVSGFS IANRSSIKRL CIIESVFEGE GSATLMSANY PGGFPEDELM TWQFVVPAHL RASVSFLNFN VSNCERKEER VEYYIPGSTT NPEVFRLEDK
QPGNMAGNFN LSLQGCDQDA QSPGILRLQF QVLVQRPQDE SNKTYMVDLS RERTMSLTIE PRPVKHGRRF VPGCFVCLES RTCSTNVTLT AGSIHKISFL
CDDLTRLWVN VEKTLSCLDH RYCYRQSFKL QVPDYILQLP VQLHDFSWKL LVPKDKLSLM LVPGQKLQQH TQERPCNTSF GYHVTSTTPG QDLYFGSFCS
GGSIEKIQVK QNSSVTLRAY APSFQQEVSK QGLIVSYTPY FKEEGIFTVT PDTKNKVYLR SPNWDRGLPA LSSVSWNISV PSNQVACLTV LKERSGLACQ
SGRAFMIIQE QQSRAEEIFS LEEEVLPKPS FHHHSFWVNI SNCSPMNGKQ LDLLFWVTLT PRTVDLAVVI GAAGGGALLL FALVLIICFV KKKKKVDKGP
AVGIYNGNVN TQMPQTQKFP KGRKDNDSHV YAVIEDTMVY GHLLQDSGGS FIQPEVDTYR PFQGPMGDCP PTPPPLFSRT PTAKFTAEEL APSSPPESES
EPYTFSHPNK GEIGVRETDI PLLHTQGPVE TEE

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
122 NRT 96 - 123
NIDCMSGPCPFGEVHLQPSTSELPILNR
Shared ( 2 )
180 NGT 174 - 185
IGTFCSNGTVSR
Shared ( 8 )
205 NVS 205 - 214
NVSGFSIANR
Shared ( 3 )
213 NRS 205 - 214
NVSGFSIANR
Shared ( 3 )
270 NVS 262 - 276
ASVSFLNFNVSNCER
Shared ( 3 )
262 - 277
ASVSFLNFNVSNCERK
Shared ( 3 )
310 NLS
342 NKT 328 - 343
LQFQVLVQRPQDESNK
Shared ( 3 )
386 NVT 382 - 396
TCSTNVTLTAGSIHK
Shared ( 3 )
477 NTS 467 - 506
LQQHTQERPCNTSFGYHVTSTTPGQDLYFGSFCSGGSIEK
Shared ( 3 )
512 NSS
577 NIS
639 NIS
642 NCS
726 NDS
Colon Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Stomach
Amide80 RCA120 ConA RCA120 AAL(+) AAL(+) RCA120 SSA RCA120 RCA120 ConA RCA120 Amide80 ConA RCA120
   
                       
 
   
               
           
               
           
       
     
           
                           
                             
                           
           
     
               
           
                             
                             
                             
                             
                             
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

GeneID InterPro KEGG MGI PhosphoSitePlus RefSeq UCSC

109332

IPR000859

mmu:109332

MGI:2442010

Q5U462

NP_598735.2

uc009sfz.1

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05