GlycoProtDB ID - GPDB0005637


Protein Name C-type mannose receptor 2
Protein Accession Number Q64449
Gene Mrc2
Length 1479
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
MVPIRPALAP WPRHLLRCVL LLGGLRLGHP ADSAAALLEP DVFLIFSQGM QGCLEAQGVQ VRVTPVCNAS LPAQRWKWVS RNRLFNLGAT QCLGTGWPVT
NTTVSLGMYE CDREALSLRW QCRTLGDQLS LLLGARASNA SKPGTLERGD QTRSGHWNIY GSEEDLCARP YYEVYTIQGN SHGKPCTIPF KYDNQWFHGC
TSTGREDGHL WCATTQDYGK DERWGFCPIK SNDCETFWDK DQLTDSCYQF NFQSTLSWRE AWASCEQQGA DLLSITEIHE QTYINGLLTG YSSTLWIGLN
DLDTSGGWQW SDNSPLKYLN WESDQPDNPG EENCGVIRTE SSGGWQNHDC SIALPYVCKK KPNATVEPIQ PDRWTNVKVE CDPSWQPFQG HCYRLQAEKR
SWQESKRACL RGGGDLLSIH SMAELEFITK QIKQEVEELW IGLNDLKLQM NFEWSDGSLV SFTHWHPFEP NNFRDSLEDC VTIWGPEGRW NDSPCNQSLP
SICKKAGRLS QGAAEEDHGC RKGWTWHSPS CYWLGEDQVI YSDARRLCTD HGSQLVTITN RFEQAFVSSL IYNWEGEYFW TALQDLNSTG SFRWLSGDEV
IYTHWNRDQP GYRRGGCVAL ATGSAMGLWE VKNCTSFRAR YICRQSLGTP VTPELPGPDP TPSLTGSCPQ GWVSDPKLRH CYKVFSSERL QEKKSWIQAL
GVCRELGAQL LSLASYEEEH FVAHMLNKIF GESEPESHEQ HWFWIGLNRR DPREGHSWRW SDGLGFSYHN FARSRHDDDD IRGCAVLDLA SLQWVPMQCQ
TQLDWICKIP RGVDVREPDI GRQGRLEWVR FQEAEYKFFE HHSSWAQAQR ICTWFQADLT SVHSQAELDF LGQNLQKLSS DQEQHWWIGL HTLESDGRFR
WTDGSIINFI SWAPGKPRPI GKDKKCVYMT ARQEDWGDQR CHTALPYICK RSNSSGETQP QDLPPSALGG CPSGWNQFLN KCFRIQGQDP QDRVKWSEAQ
FSCEQQEAQL VTIANPLEQA FITASLPNVT FDLWIGLHAS QRDFQWIEQE PLLYTNWAPG EPSGPSPAPS GTKPTSCAVI LHSPSAHFTG RWDDRSCTEE
THGFICQKGT DPSLSPSPAA TPPAPGAELS YLNHTFRLLQ KPLRWKDALL LCESRNASLA HVPDPYTQAF LTQAARGLQT PLWIGLASEE GSRRYSWLSE
EPLNYVSWQD EEPQHSGGCA YVDVDGTWRT TSCDTKLQGA VCGVSRGPPP RRINYRGSCP QGLADSSWIP FREHCYSFHM EVLLGHKEAL QRCQKAGGTV
LSILDEMENV FVWEHLQTAE AQSRGAWLGM NFNPKGGTLV WQDNTAVNYS NWGPPGLGPS MLSHNSCYWI QSSSGLWRPG ACTNITMGVV CKLPRVEENS
FLPSAALPES PVALVVVLTA VLLLLALMTA ALILYRRRQS AERGSFEGAR YSRSSHSGPA EATEKNILVS DMEMNEQQE

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
68 NAS 63 - 75
VTPVCNASLPAQR
Shared ( 4 )
101 NTT
139 NAS 137 - 153
ASNASKPGTLERGDQTR
Shared ( 4 )
137 - 148
ASNASKPGTLER
Shared ( 4 )
232 NDC
363 NAT 361 - 378
KPNATVEPIQPDRWTNVK
Shared ( 3 )
360 - 378
KKPNATVEPIQPDRWTNVK
Shared ( 3 )
360 - 373
KKPNATVEPIQPDR
Shared ( 3 )
491 NDS
496 NQS 490 - 504
WNDSPCNQSLPSICK
Shared ( 3 )
490 - 505
WNDSPCNQSLPSICKK
Shared ( 3 )
587 NST
633 NCT
953 NSS 951 - 981
RSNSSGETQPQDLPPSALGGCPSGWNQFLNK
Shared ( 3 )
980 NKC
1028 NVT
1133 NHT 1109 - 1137
GTDPSLSPSPAATPPAPGAELSYLNHTFR
Shared ( 2 )
1156 NAS 1156 - 1176
NASLAHVPDPYTQAFLTQAAR
Shared ( 2 )
1147 - 1176
DALLLCESRNASLAHVPDPYTQAFLTQAAR
Shared ( 2 )
1348 NYS
1365 NSC
1384 NIT
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Testis
RCA120 Amide80 RCA120 Amide80 ConA RCA120 ConA RCA120 AAL(+) AAL(+) AAL RCA120 RCA120 RCA120 ConA RCA120 Amide80 ConA RCA120 RCA120
       
 
 
       
                                       
   
 
   
     
       
 
             
           
       
                                       
     
       
   
           
   
                           
 
             
   
     
     
                                       
     
     
   
             
             
                       
                                       
                                       
 
 
       
     
   
     
                                       
                                       
           
             
         
             
 
               
                 
                   
                                       
                                       
                                       
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05