GlycoProtDB ID - GPDB0005704


Protein Name Attractin-like protein 1
Protein Accession Number Q6A051
Gene Atrnl1
Length 1378
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
MEPGVRARSG APQPASPVLW RARPAGGGGA SSWLLLDGNS WLLCYGFLYL ALYAQVSQSK PCERTGSCFS GRCVNSTCLC DPGWVGDQCQ HCQGRFKLTE
PSGYLTDGPI NYKYKTKCTW LIEGYPNAVL RLRFNHFATE CSWDHMYVYD GDSIYAPLVA VLSGLIVPEV RGNETVPEVV TTSGYALLHF FSDAAYNLTG
FNIFYSINSC PNNCSGHGKC TTSVSVASQV YCECDKYWKG EACDIPYCKA NCGSPDHGYC DLTGEKLCVC NDSWQGPDCS LNVPSTESYW ILPNVKPFSP
SVGRASHKAV LHGKFMWVIG GYTFNYSSFQ MVLNYNLESS IWNVGAVSRG PLQRYGHSLA LYQENIFMYG GRMETSDGNV TDELWVFNVR SQSWSTKTPT
VLGHSQQYAV EGHSAHIMEL DSRDVVMIVI FGYSAIYGYT SSIQEYHISS NTWLVPETKG AIVQGGYGHT SVYDEVTKSI YVHGGYKALP GNKYGLVDDL
YKYEVNTRTW TILKESGFAR YLHSAVLING AMLIFGGNTH NDTSLSNGAK CFSADFLAYD IACDEWKTLP KPNLHRDVNR FGHSAVVING SMYIFGGFSS
VLLNDILVYK PPNCKAFRDE ELCRNAGPGI KCVWNKNHCE SWESGNTNNI LRAKCPPKTA ATDDRCYRYA DCASCTANTN GCQWCDDKKC ISASSNCSTS
VRNYTKCHIR NEQICNKLTS CKSCSLNLNC QWDQRQQECQ ALPAHLCGEG WNHVGDACLR INSSRESYDN AKLYCYNLSG NLASLTTSKE VEFVLDEIQK
FTQQKVSPWV GLRKINISYW GWEDMSPFTN TSLQWLPGEP NDSGFCAYLE RAAVAGLKAN PCTSMADGLV CEKPVVSPNQ NARPCKKPCS LRTSCANCTS
SGMECMWCSS TKRCVDSNAY IISFPYGQCL EWQTATCSPQ NCSGLRTCGQ CLEQPGCGWC NDPSNTGRGY CIEGSSRGPM KLAGVHNSDV VLDTSLCPKE
KNYEWSFIQC PACQCNGHST CINNNVCEQC KNLTTGRQCQ ECMPGYYGDP TNGGQCTACT CGGHANVCHL HTGKCFCTTK GIKGDQCQLC DSENRYVGNP
LRGTCYYSLL IDYQFTFSLL QEDDRHHTAI NFIANPEQSN KNLDISINAS NNFNLNITWS VGSTGGTISG EETPIVSKTN IKEYRDSFSY EKFNFRSNPN
IT
FYVYVSNF SWPIKIQIAF SQHNTIMDLV QFFVTFFSCF LSLLLVAAVV WKIKQTCWAS RRREQLLRER QQMASRPFAS VDVALEVGAE QTDFLRGPLE
GAPKPIAIEP CAGNRAAVLT VFLCLPRGSS GAPPPGQSGL AIASALIDIS QQKPSDNKDK TSGVRNRKHL STRQGTCV

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
75 NST 73 - 95
CVNSTCLCDPGWVGDQCQHCQGR
Shared ( 2 )
173 NET
197 NLT
208 NSC
212 NNC
213 NCS
271 NDS
325 NYS
379 NVT
541 NDT
589 NGS
637 NHC
680 NGC
696 NCS 690 - 702
CISASSNCSTSVR
Shared ( 3 )
703 NYT
762 NSS
777 NLS
816 NIS
830 NTS
841 NDS
897 NCT
941 NCS 913 - 946
RCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLR
Shared ( 3 )
1025 NVC
1032 NLT
1066 NVC
1148 NAS
1156 NIT
1200 NIT
1209 NFS
Brain Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Lung Stomach
ConA AAL(+) AAL(+) ConA RCA120 ConA ConA
 
   
             
             
             
             
             
             
             
             
             
             
             
             
 
     
             
             
             
             
             
             
             
       
   
             
             
             
             
             
             
             
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05