GlycoProtDB ID - GPDB0005709


Protein Name ATP-binding cassette sub-family A member 3
Protein Accession Number Q6AXE3
Gene Abca3
Length 1449
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
MAVLRQLTLL LWKNYTLKKR KVLVTVLELF LPLLFSGILI WLRLKIQSEN VPNATVYPDQ SIQELPLFFS FPPPGGTWEL AYVPSHSDAA RTITETVKRE
FMIKMRVHGF SSEKDFEDYI RYDNHSSSVL AAVVFEHSFN HSQDPLPLAV KYHLRFSYTR RNYMWTQTGN IFLKETEGWH TTSLFPLFPS PGPREPSSPD
GGEPGYIREG FLAMQHAVDK AIMRYHANTS AQQLFQKLMV ITKRFPFPPY ISDPFLIAIQ YQLPLLLMLS FTYTSLTIIR AVVQEKEKKL KEYMRMMGLN
SWLHWSAWFL MFFLFFLIVV SFMTLLFCVK VKKDIAVLSN SDPSLVLAFL LCFAISSISF SFMVSTFFSK ANIAAAVGGF LYFFTYTPYF FVAPRYNWMT
LSQKLLSCLL SNVAMAMGAQ LIGKFEAKGT GIQWRDLLNP VNVDDNFCFG QVLGMLLLDS ALYGLVTWYV EAVFPGQFGV PQPWHFFLMP SYWCGNPRTV
VGKEEEGSDP EKALRNEYFE AEPEDLVAGI KIKHLSKVFQ VGNKDKMGIR DLTLNLYEGQ ITVLLGHNGA GKTTTMSLLT GLFPPTSGHA YIHGYEISQD
MAQIRKSLGL CPQHDVLFDN LTVAEHLYFY AQLKGLSLQK CPEEVKQMLH ILSLEDKRDL RSKFLSGGMK RKLSIGIALI AGSKVLMLDE PTSGMDAVSR
RAIWDLLQQQ KSDRTVLLTT HFMDEADLLG DRIAILAKGE LQCCGSSLFL KQKYGAGYHM TLVKEPHCNP EGISQLVHHH VPNAMLESHA GAELSFILPK
ESTHRFESLF AKLEKKQKEL GIASFGASVT TMEEVFLRGR KGFDIALNLL IAMAFLASTF SILAVSERAV QAKHVQFVSG VHVATFWFSA LLWDLISFLV
PSLLLLVVFQ AFNVHAFTRD GHMADLLLLL MLYGWAIIPL MYLMSFFFSA ASTAYTRLTI FNILSGIATF IMVTIMRIPA VKLEELSRTL DHVFLVLPNH
C
LGMAVSNFY ENYETRRYCT SSELAAHYCK KYNIQYQESF YAWSTPGVGK FVTSMAASGG IYLTLLFLIE TNLLWRLRTF ICAFRRRWTL AELQNRTSVL
PEDQDVAEER SRILVPSLDS MLDTPLIINE LSKVYDQRAP LLAVDRISLA VQKGECFGLL GFNGAGKTTT FKMLTGEETI TSGDAFVGGY SISSDIGKVR
QRMGYCPQFD ALLDHMTGRE MLVMYARLRG IPERLINACV ENTLRGLLLE PHANKLVKTY SGGNKRKLST GIALIGEPAV IFLDEPSTGM DPVARRLLWD
TVARARESGK AIVITSHSME ECEALCTRLA IMVQGQFKCL GSPQHLKSKF GSGYSLQAKV RSEGKQDALE EFKAFVDLTF PGSILEDEHQ DMVHYHLPGC
DLSWAKVFGI LEKAKEKYGV DDYSVSQISL EQVFLSFAHL QPPTTEDGR

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
14 NYT
53 NAT
124 NHS 122 - 151
YDNHSSSVLAAVVFEHSFNHSQDPLPLAVK
Shared ( 3 )
140 NHS 122 - 151
YDNHSSSVLAAVVFEHSFNHSQDPLPLAVK
Shared ( 3 )
228 NTS 225 - 237
YHANTSAQQLFQK
Shared ( 4 )
446 NFC
620 NLT
999 NHC
1095 NRT
1237 NAC
Brain Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung
ConA AAL AAL(+) AAL(+) RCA120 RCA120 ConA
             
             
   
 
   
 
             
             
             
             
             
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05