GlycoProtDB ID - GPDB0005746


Protein Name Beta-2 glycoprotein I (Fragment)
Protein Accession Number Q6LAL7
Gene
Length 323
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
CPKPDDLPFA TVVPLKTSYD PGEQIVYSCK PGYVSRGGMR RFTCPLTGMW PINTLRCVPR VCPFAGILEN GIVRYTSFEY PKNISFACNP GFFLNGTSSS
KCTEEGKWSP DIPACARITC PPPPVPKFAL LKDYRPSAGN NSLYQDTVVF KCLPHFAMIG NDTVMCTEQG NWTRLPECLE VKCPFPPRPE NGYVNYPAKP
VLLYKDKATF GCHETYKLDG PEEAECTKTG TWSFLPTCRE SCKLPVKKAT VLYQGMRVKI QEQFKNGMMH GDKIHFYCKN KEKKCSYTVE AHCRDGTIEI
PSCFKEHSSL AFWKTDASEL TPC

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
83 NIS 75 - 101
YTSFEYPKNISFACNPGFFLNGTSSSK
Shared ( 4 )
83 - 101
NISFACNPGFFLNGTSSSK
Shared ( 4 )
75 - 107
YTSFEYPKNISFACNPGFFLNGTSSSKCTEEGK
Shared ( 4 )
95 NGT 83 - 101
NISFACNPGFFLNGTSSSK
Shared ( 4 )
75 - 101
YTSFEYPKNISFACNPGFFLNGTSSSK
Shared ( 4 )
83 - 101
NISFACNPGFFLNGTSSSK
Shared ( 4 )
75 - 107
YTSFEYPKNISFACNPGFFLNGTSSSKCTEEGK
Shared ( 4 )
140 NNS 133 - 151
DYRPSAGNNSLYQDTVVFK
Shared ( 3 )
128 - 151
FALLKDYRPSAGNNSLYQDTVVFK
Shared ( 3 )
161 NDT 152 - 182
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
152 - 182
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
152 - 174
CLPHFAMIGNDTVMCTEQGNWTR
Shared ( 3 )
152 - 174
CLPHFAMIGNDTVMCTEQGNWTR
Shared ( 3 )
152 - 174
CLPHFAMIGNDTVMCTEQGNWTR
Shared ( 3 )
152 - 182
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
152 - 182
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
171 NWT 152 - 182
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
152 - 182
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
152 - 182
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
152 - 174
CLPHFAMIGNDTVMCTEQGNWTR
Shared ( 3 )
152 - 174
CLPHFAMIGNDTVMCTEQGNWTR
Shared ( 3 )
152 - 174
CLPHFAMIGNDTVMCTEQGNWTR
Shared ( 3 )
152 - 182
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
152 - 182
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Serum Skeletal_muscle Stomach Testis
RCA120 Amide80 ConA RCA120 ConA RCA120 ConA RCA120 AAL(+) AAL(+) AAL ConA RCA120 SSA RCA120 RCA120 ConA RCA120 Amide80 Amide80 RCA120 Amide80 ConA RCA120 RCA120
           
   
 
         
         
     
       
 
 
                                   
           
                           
                   
           
   
 
         
         
     
       
 
 
                                   
           
           
   
         
                                   
           
                           
     
           
 
     
                 
 
                       
                     
                       
                       
                                   
           
       
                 
   
           
       
                         
   
 
                           
     
           
 
     
                 
 
                           
                   
                       
                     
                       
                       
                                   
           
       
                 
   
           
       
                         
   
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05