GlycoProtDB ID - GPDB0005755


Protein Name Adenylate cyclase activating polypeptide 1 receptor 1
Protein Accession Number Q6NXJ9
Gene Adcyap1r1
Length 468
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MARTLQLSLT ALLLLPMAIA MHSDCIFKKE QAMCLERIQR ANDLMGLNES SPGCPGMWDN ITCWKPAQIG EMVLVSCPEV FRIFNPDQVW MTETIGDSGF
ADSNSLEITD MGVVGRNCTE DGWSEPFPHY FDACGFDDYE PESGDQDYYY LSVKALYTVG YSTSLVTLTT AMVILCRFRK LHCTRNFIHM NLFVSFMLRA
ISVFIKDWIL YAEQDSSHCF VSTVECKAVM VFFHYCVVSN YFWLFIEGLY LFTLLVETFF PERRYFYWYT IIGWGTPTVC VTVWAVLRLY FDDAGCWDMN
DS
TALWWVIK GPVVGSIMVN FVLFIGIIII LVQKLQSPDM GGNESSIYLR LARSTLLLIP LFGIHYTVFA FSPENVSKRE RLVFELGLGS FQGFVVAVLY
CFLNGEVQAE IKRKWRSWKV NRYFTMDFKH RHPSLASSGV NGGTQLSILS KSSSQLRMSS LPADNLAT

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
48 NES 41 - 82
ANDLMGLNESSPGCPGMWDNITCWKPAQIGEMVLVSCPEVFR
Shared ( 9 )
60 NIT 41 - 82
ANDLMGLNESSPGCPGMWDNITCWKPAQIGEMVLVSCPEVFR
Shared ( 9 )
117 NCT
300 NDS
343 NES
375 NVS
Brain
AAL
 
 
 
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05