GlycoProtDB ID - GPDB0005787


Protein Name Carboxypeptidase A4
Protein Accession Number Q6P8K8
Gene Cpa4
Length 420
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MKWLLFFGAL IGAGICGRDK FFGDQVFRIN VRNGDEIRKL TELVNSDHLK LSVWKSPSTF DRPVDILVPS VSLLPVKSFL KSQGLDYSVT IEDLQALLDN
EDEEMQHNEG IERSGDFNYG AYHPLEAIYH EMDSIATDFP ELVSRVKIGE TFEKRPMYVL KFSTGGGKKR PAIWLNAGIH AREWISQATA IWTARKIVTD
YKKDPAITSI LKKVDIFLLP VANPDGYVYT QSQNRLWRKT RSRNPGSRCV GADPNRNWNA SFAGEGTSDN PCSEVYHGSH PNSEVEVKSV VDFIQKHGNF
KCFIDLHSYS QLLMYPYGYT VKKAPDAEEL DDVARNAAQA LASLSGTKYR VGPTCTTVYP ASGSSVDWAY DNGIKYAFTF ELRDTGYYGF LLPASQIIPT
AEETWLGLKT IMEHVRDHLY

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
259 NAS 249 - 288
CVGADPNRNWNASFAGEGTSDNPCSEVYHGSHPNSEVEVK
Unique
Stomach
ConA
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05