GlycoProtDB ID - GPDB0005835


Protein Name All-trans retinoic acid-induced differentiation factor
Protein Accession Number Q6PGD0
Gene Atraid
Length 223
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
MASRESGGSR AAALLLVLGV ERALALPEIC TLCPGGMHNL SRVAAYCEDT SKLMQARCCL NQKGTILGLD LQNCSLKDPG PNFLQAYTAI IIDLQANPLK
DDLANTFRGF TQLQTLILPQ DVPCPGGSNA WDNVTSFKDK QICQGQRDLC NSTGSPEMCP ENGSCASDGP GLLQCVCADG FHGYKCMRQG SFSLLMFFGI
LGSTTLAISI LLWGTQRRKA KAS

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
39 NLS 26 - 42
LPEICTLCPGGMHNLSR
Shared ( 4 )
73 NCS 64 - 77
GTILGLDLQNCSLK
Shared ( 6 )
133 NVT 101 - 138
DDLANTFRGFTQLQTLILPQDVPCPGGSNAWDNVTSFK
Shared ( 4 )
109 - 138
GFTQLQTLILPQDVPCPGGSNAWDNVTSFK
Shared ( 4 )
151 NST 148 - 185
DLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYK
Shared ( 4 )
148 - 185
DLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYK
Shared ( 4 )
162 NGS 148 - 185
DLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYK
Shared ( 4 )
148 - 185
DLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYK
Shared ( 4 )
Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Skeletal_muscle Stomach Testis
Amide80 Amide80 ConA AAL(+) AAL(+) RCA120 RCA120 Amide80 ConA Amide80 ConA
     
           
 
                 
 
     
             
       
           
               
   
     
             
               
   
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05