GlycoProtDB ID - GPDB0005856


Protein Name Calcium-activated chloride channel regulator 4A
Protein Accession Number Q6Q473
Gene Clca4a
Length 924
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
MAFSRGPVFL LLLLYLLWGS DTSLIRLNEN GYEDIIIAID PAVPEDTTII EHIKGMVTKA STYLFEATEK RFFFKNVSIL IPESWKDSPQ YRRPKQESYK
HADIKVAPPT VEGRDEPYTR QFTQCEEKAE YIHFTPDFVL GRKQDEYGDS GKVLVHEWAH LRWGVFDEYN EDQPFYSASS KKIEATRCST GITGTNRVYA
CQGGSCAMRR CRTNSTTKLY EKDCQFFPDK VQSEKASIMF MQSIDSVTEF CKKENHNREA PTLHNKKCNY RSTWEVISTS EDFNSSTPME TSPSPPFFSL
LRISERIMCL VLDVSGSMTS YDRLNRMNQA AKYFLSQIIE NRSWVGMVHF SSQATIVHEL IQINSDIERN QLLQTLPTSA NGGTSICSGI KAAFQVFKNG
EYQTDGTEIL LLSDGEDSTA KDCIDEVKDS GSIVHFIALG PLADLAVTNM SILTGGNHKL ATDEAQNNGL IDAFGALASE NADITQKSLQ LESKGAILNN
S
LWLNDTVVI DSTLGRDTFF LVTWSKQAPA IYLRDPKGTQ TTNFTMDSAS KMAYLSIPGT AQVGVWTYNL EAKENSEILT ITVTSRAANS SVPPITVNAK
VNTDTNTFPS PMIVYAEVLQ GYTPIIGARV TATIESNSGK TEELVLLDNG AGADAFKDDG VYSRFFTAYS VNGRYSLKVR ADGGRNSARR SLRHPSSRAA
YIPGWVVDGE IQGNPPRPET TEATQPVLEN FSRTASGGAF VVSNVPSGPL PDLYPPNQIT DLQATLDGEE ISLTWTAPGD DYDVGRVQQY IIRTSKNIIE
LRDNFNNSPR VDTTNLTPKE ANSEETFAFK PENITEENAT YIFIAIESVD KSSLSSGPSN IAQVALFTPQ AEPDPDESPS SSGVSVATIV LSVLGALVLV
CIIVGTTICI LKNKRSSSAA ITKF

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
76 NVS 76 - 86
NVSILIPESWK
Shared ( 5 )
214 NST
284 NSS
341 NRS 333 - 342
YFLSQIIENR
Shared ( 4 )
449 NMS
499 NNS
505 NDT
543 NFT 538 - 551
GTQTTNFTMDSASK
Shared ( 3 )
589 NSS 587 - 600
AANSSVPPITVNAK
Shared ( 3 )
730 NFS
806 NNS
815 NLT
833 NIT 820 - 851
EANSEETFAFKPENITEENATYIFIAIESVDK
Shared ( 3 )
838 NAT 820 - 851
EANSEETFAFKPENITEENATYIFIAIESVDK
Shared ( 3 )
Colon Skeletal_muscle
Amide80 ConA RCA120 ConA
     
       
       
     
       
       
       
 
 
 
       
       
       
   
 
   
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05