GlycoProtDB ID - GPDB0005949


Protein Name Als splice variant 1
Protein Accession Number Q791Q5
Gene Igfals
Length 603
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
MALRTGSPAL VVLLAFWVAL GPCYLQGTDP GASADAEGPQ CPVTCTCSYD DYTDELSVFC SSRNLTQLPD GIPVSTRALW LDGNNLSSIP SAAFQNLSSL
DFLNLQGSWL RSLEPQALLG LQNLYHLHLE RNLLRSLAAG LFRHTPSLAS LSLGNNLLGR LEEGLFRGLS HLWDLNLGWN SLVVLPDTVF QGLGNLHELV
LAGNKLTYLQ PALLCGLGEL RELDLSRNAL RSVKANVFIH LPRLQKLYLD RNLITAVAPR AFLGMKALRW LDLSHNRVAG LLEDTFPGLL GLHVLRLAHN
AITSLRPRTF KDLHFLEELQ LGHNRIRQLG EKTFEGLGQL EVLTLNDNQI HEVKVGAFFG LFNVAVMNLS GNCLRSLPEH VFQGLGRLHS LHLEHSCLGR
IRLHTFAGLS GLRRLFLRDN SISSIEEQSL AGLSELLELD LTANQLTHLP RQLFQGLGQL EYLLLSNNQL TMLSEDVLGP LQRAFWLDLS HNRLETPAEG
LFSSLGRLRY LNLRNNSLQT FVPQPGLERL WLDANPWDCS CPLKALRDFA LQNPGVVPRF VQTVCEGDDC QPVYTYNNIT CAGPANVSGL DLRDISETLF
VHC

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
64 NLT
85 NLS
96 NLS
368 NLS
515 NNS 510 - 529
YLNLRNNSLQTFVPQPGLER
Shared ( 5 )
515 - 529
NNSLQTFVPQPGLER
Shared ( 5 )
578 NIT 560 - 593
FVQTVCEGDDCQPVYTYNNITCAGPANVSGLDLR
Shared ( 5 )
560 - 593
FVQTVCEGDDCQPVYTYNNITCAGPANVSGLDLR
Shared ( 5 )
586 NVS 560 - 593
FVQTVCEGDDCQPVYTYNNITCAGPANVSGLDLR
Shared ( 5 )
Liver: b4GalT-I(+/+) Serum
RCA120 Amide80
   
   
   
   
 
 
 
 
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05