GlycoProtDB ID - GPDB0006028


Protein Name ADAMTS-like protein 4
Protein Accession Number Q80T21
Gene Adamtsl4
Length 1036
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
MESWLGRLWL CMMLLLPLPQ PCQDQELFGP SHQLPSEEGQ VPEGLWGPWG RWASCSQPCG VGVQRRSRTC ELHPALPLPP RPPRHPEAHR PRGQGSRPQT
PRDPQSLYRP QPRGRGGPLR APASQVGREE TQEPQGAQRF RVRDPIKPGM FGYGRVPFAL PLHRSRRHPH RPGQPKNSST GEGMVPSQPP STELASEKHG
PHMQPPEPRS HSAETPRSGT AQTEVLPRTS SAPSYTGTPA PTSSFGDSRS FQGSLGPRMP PSPGSWSSPQ GAERRHPPPF SPVPRSQQSR RHWRPPGPHR
SPDGWLPLTR DSSPLWSIFA PSIPAPNCSG ESEQMRACSQ EPCPPEQPDP RALQCAAFDS QEFMGQLYQW EPFTEVQGSQ RCELNCRPRG FRFYVRHTEK
VQDGTLCQPG SLDICVAGRC LSPGCDGVLG SGRRPDGCGV CGGDGSTCRL VSGNLTDRGG PLGYQKILWI PAGASHLHIS QLRPSSNYLA LRGPGGRSII
NGNWAVDPPG SYTAIGTVFQ YNRPPREEGK GESLSAEGPT TQPVDVYMIF QEDNPGVFYQ YVISSPPAVL ESPSTKPPAL QPQPEMLRGE PLLPSAPRPV
RAPGTLQRQV RIPQVPPPTR VRTAMGSSAG YWKQVGHSEC SASCGKGVWH PIFLCISRES GEELDEQSCA VGARPPASPE PCHGPPCPPY WEAGEWTSCS
RSCGPGTQHR QLLCRQEFGG GGSSVPPERC GHLPRPNITQ PCQLHLCGHW EISSPWSQCS VRCGRGQRSR QVRCVGSNGD EVDKQECASG PPPPPSREAC
DMGPCTTAWF YSDWSSKCSA ECGTGIQRRA VVCLRSGETL QGDPEAGSTE QGCPLRSRPP DMRACSLGPC ERTWRWFTGP WSECSSECGS GTQHRDIICV
SKLGAEFNVT SPSNCSHLPR PPALQPCQGQ ACEDKWFSTL WSPCSRSCQG GMQTREVQCL SGNQTLSSRC PPHLRPSRKR PCNSQPCNQR PDDQCKDSSP
HCPLVVQARL CVYPYYTTTC CRSCAHVLEQ SQLEPA

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
177 NSS
327 NCS
454 NLT
737 NIT
908 NVT 903 - 935
LGAEFNVTSPSNCSHLPRPPALQPCQGQACEDK
Shared ( 2 )
914 NCS 903 - 935
LGAEFNVTSPSNCSHLPRPPALQPCQGQACEDK
Shared ( 2 )
963 NQT 956 - 969
EVQCLSGNQTLSSR
Shared ( 2 )
Heart Kidney Kidney(Fut9 KO) Lung Skeletal_muscle Stomach
ConA RCA120 AAL(+) RCA120 ConA ConA
           
           
           
           
     
     
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05