GlycoProtDB ID - GPDB0006144


Protein Name C730048C13Rik protein
Protein Accession Number Q810T7
Gene Slc22a30
Length 480
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MAFQELLNQV GSLGRFQILQ ISFVLFLVGL VVPHITMENF TAAIPNHRCW APILDNDTAS DNGSRILSQD DLLRISIPLD SNLRLDKCRR FAQPQWHLLH
LNGTFSNETE PDTEPCVDGW VYDRSNFLST IVTEWDLVCE SQALNSVAKF SFMIGLFIGA IICGHLSDRF GRKFILTCAL LQFAITETCV AFAPSFFIYC
LLRFLAGMSV EPISVNSHLL MLEWTSPKFL GMVAVLTSCA ASIGYMILAG LAFLFRIWRH LQLAMSVPIF FFLILTRWMS ESARWLIVTN KPQKGLKELR
KVAHMNGMKN SGNTLTMEVV EASMKNELEA AKRKSSPRDL FHTPILRKRI CVLSFMRYLF TVSIFGLSLH LQHLSTNIIL LQFLSSALGI LISVIGHFVL
NHMGRRITQL VLMSLRGIFM LTAVFVPQVG KSQDKQRRRI PSLKSQGFEE LLELPSDPRE ENFVQDMVTI FSDDYSEFFF

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
39 NFT
56 NDT 49 - 65
CWAPILDNDTASDNGSR
Shared ( 6 )
49 - 74
CWAPILDNDTASDNGSRILSQDDLLR
Shared ( 6 )
62 NGS 49 - 65
CWAPILDNDTASDNGSR
Shared ( 6 )
49 - 74
CWAPILDNDTASDNGSRILSQDDLLR
Shared ( 6 )
102 NGT 91 - 124
FAQPQWHLLHLNGTFSNETEPDTEPCVDGWVYDR
Shared ( 6 )
91 - 124
FAQPQWHLLHLNGTFSNETEPDTEPCVDGWVYDR
Shared ( 6 )
107 NET 91 - 124
FAQPQWHLLHLNGTFSNETEPDTEPCVDGWVYDR
Shared ( 6 )
Kidney Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-)
AAL ConA AAL RCA120 RCA120 RCA120
           
 
     
   
 
     
   
       
         
       
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05