GlycoProtDB ID - GPDB0006382


Protein Name Bis(5'-adenosyl)-triphosphatase enpp4
Protein Accession Number Q8BTJ4
Gene Enpp4
Length 456
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MFNMKILVIP LFWGLVTGYK GNSSDSSAPR LLLVSFDGFR ADYLKSYDLP HLQNFIKEGV LVEHVKNVFI TKTFPNHYSI VTGLYEESHG IVANSMYDSV
TKKHFSESND KDPFWWNGAE PIWVTNQLQE NRSSAAAMWP GTDVPIHNIT ASYFMNYSSS VSFKERLGNV TTWLSSSNPP VTFAALYWEE PDVSGHKYGP
EDKENMRRVL KEVDDLIGDI VLKLKVLGLW DSLNVIITSD HGMAQCSKNR LIDLDSCIDR SNYSVIDLTP VAAILPKINV TEVYDKLKRC NPHMNVYLKE
AIPNRFYYQH SSRIQPIILV AEEGWTITLN KSSFKLGDHG YDNSLPSMHP FLAAHGPAFR KGYRQSTINT VDIYPMMCHI LGLKPHPNNG TLSHTKCLLV
DQWCINLPEA IGIVVSALLV LTMLTGLMIF MRSRASTSRP FSRLQLQEDD DDPLID

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
22 NSS
131 NRS 112 - 132
DPFWWNGAEPIWVTNQLQENR
Shared ( 2 )
148 NIT 133 - 164
SSAAAMWPGTDVPIHNITASYFMNYSSSVSFK
Unique
133 - 164
SSAAAMWPGTDVPIHNITASYFMNYSSSVSFK
Unique
156 NYS 133 - 164
SSAAAMWPGTDVPIHNITASYFMNYSSSVSFK
Unique
133 - 164
SSAAAMWPGTDVPIHNITASYFMNYSSSVSFK
Unique
169 NVT 165 - 197
ERLGNVTTWLSSSNPPVTFAALYWEEPDVSGHK
Unique
262 NYS
279 NVT 278 - 288
INVTEVYDKLK
Shared ( 2 )
278 - 286
INVTEVYDK
Shared ( 2 )
278 - 289
INVTEVYDKLKR
Shared ( 2 )
330 NKS 314 - 331
IQPIILVAEEGWTITLNK
Shared ( 2 )
389 NGT
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach Testis
ConA Amide80 Amide80 RCA120 RCA120 AAL(+) AAL(+) RCA120 RCA120 RCA120 ConA Amide80 ConA Amide80 RCA120
                             
 
       
 
 
 
               
           
     
         
   
   
               
           
     
         
   
   
               
           
                             
     
   
   
       
 
     
 
       
             
             
 
     
 
       
 
                             
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05