GlycoProtDB ID - GPDB0006413


Protein Name Beta-1,4-glucuronyltransferase 1
Protein Accession Number Q8BWP8
Gene B4gat1
Length 415
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MQMSYAIRCA FYQLLLAALM LVAMLQLLYL SLLSGLHGQE EQEQYFEFFP PSPRSVDQVK SQLRTALASG GVLDASGDYR VYRGLLKTTM DPNDVILATH
ASVDNLLHLS GLLERWEGPL SVSVFAATKE EAQLATVLAY ALSSHCPEMR ARVAMHLVCP SRYEAAVPDP REPGEFALLR SCQEVFDKLA RVAQPGINYA
LGTNTSYPNN LLRNLAREEA NYALVIDVDM VPSEGLWRGL REMLDQSNHW DGTALVVPAF EIRRSRRMPM NKNELVQLYQ VGEVRPFYYG LCTPCHAPTN
YS
RWVNLPEE SLLRPAYVVP WRDPWEPFYV AGGKVPTFDE RFRQYGFNRI SQACELHVAG FNFEVLNEGF LVHKGFKEAL KFHPQKEAEN QRNKILYRQF
KQELKARYPN SPHRC

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
204 NTS 192 - 213
VAQPGINYALGTNTSYPNNLLR
Shared ( 2 )
300 NYS 273 - 303
NELVQLYQVGEVRPFYYGLCTPCHAPTNYSR
Shared ( 2 )
Brain Colon Heart Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Skeletal_muscle Stomach
ConA Amide80 Amide80 ConA AAL(+) AAL(+) AAL RCA120 RCA120 RCA120 ConA ConA
         
   
   
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

GeneID KEGG MGI PhosphoSitePlus RefSeq UCSC

108902

mmu:108902

MGI:1919680

Q8BWP8

NP_780592.1

uc008gbx.1

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05