GlycoProtDB ID - GPDB0006675


Protein Name Carbonic anhydrase 12
Protein Accession Number Q8CI85
Gene Ca12
Length 354
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
MPHRSLRATV VLLLVILKKQ PSSSAPLNGS KWTYVGPAGE KNWSKKYPSC GGLLQSPIDL HSDILQYDAS LAPLQFQGYN VSVEKLLNLT NDGHSVRLNL
NSDMYIQGLQ PHHYRAEQLH LHWGNRNDPH GSEHTVSGKH FAAELHIVHY NSDLYPDFST ASDKSEGLAV LAVLIEIGSA NPSYDKIFSH LQHVKYKGQQ
VLIPGFNIEE LLPESPGEYY RYEGSLTTPP CYPTVLWTVF RNPVQISQEQ LLALETALYF THMDDPTPRE MINNFRQVQK FDERLVYISF RQGLLTDTGL
SLGIILSVAL AGVLGISIVL AVSIWLFKRK KSKKGDNKGV IYKPAIKKEA EVHA

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
28 NGS
42 NWS
80 NVS 46 - 85
KYPSCGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVEK
Shared ( 5 )
66 - 85
QYDASLAPLQFQGYNVSVEK
Shared ( 5 )
47 - 85
YPSCGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVEK
Shared ( 5 )
70 - 85
SLAPLQFQGYNVSVEK
Shared ( 5 )
68 - 85
DASLAPLQFQGYNVSVEK
Shared ( 5 )
71 - 85
LAPLQFQGYNVSVEK
Shared ( 5 )
67 - 85
YDASLAPLQFQGYNVSVEK
Shared ( 5 )
88 NLT 86 - 97
LLNLTNDGHSVR
Shared ( 5 )
Brain Colon Kidney Kidney(Fut9 KO) Kidney(Fut9 WT)
RCA120 Amide80 AAL RCA120 AAL(+) AAL(+)
           
           
       
       
       
 
       
         
       
       
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05