GlycoProtDB ID - GPDB0006678


Protein Name Biotinidase
Protein Accession Number Q8CIF4
Gene Btd
Length 520
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
MSGARTAPAL FFLGCSALAL GVSSASQEHR EAEYYVAAVY EHPSVLSPNP LELVSRQEAL ELMKQNLDVY EQQVMAAAQK GVQIIVFPED GIHGFNFTRT
SIYPFLDFMP SPKLVRWNPC LEPFRFNDTE VLQRLSCMAI KGGMFLVANL GTKQPCLSSD PGCPQDGRYQ FNTNVVFSDN GTLVDRYRKH NLYFEAAFDT
PANVDLITFD TPFAGKFGVF TCFDILFFDP AVRLLRDFEV KHIVYPTAWM NQLPLLAAIE IQKAFATAFG VNVLAANIHH PTLGMTGSGI HTPLKSFWYH
DMDDPKGHLI IAQVATNPQG LTGTGNTTSE MDPSHRKFLK ILSGDPYCEK DAQEVHCDEA AKWNVNVPPT FHSEMMYDNF TLVPVWGTEG HLQVCSNSLC
CHLLYERPTL SKELYALGVF DGLHTVHGTY YIQTCALVKC GGLGFDTCGQ EITEAEGLFD FHLWGNFSTL YIFPLFLTSG MTLDTPDQLG WENDHYFLRK
RGLSSGLVTA ALYGRLYERK

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
96 NFT 81 - 99
GVQIIVFPEDGIHGFNFTR
Shared ( 2 )
127 NDT 126 - 134
FNDTEVLQR
Shared ( 7 )
180 NGT 169 - 186
YQFNTNVVFSDNGTLVDR
Shared ( 2 )
326 NTT 307 - 337
GHLIIAQVATNPQGLTGTGNTTSEMDPSHRK
Shared ( 2 )
307 - 337
GHLIIAQVATNPQGLTGTGNTTSEMDPSHRK
Shared ( 2 )
307 - 336
GHLIIAQVATNPQGLTGTGNTTSEMDPSHR
Shared ( 2 )
307 - 336
GHLIIAQVATNPQGLTGTGNTTSEMDPSHR
Shared ( 2 )
379 NFT
466 NFS
Brain Colon Heart Kidney Kidney(Fut9 KO) Liver Liver: b4GalT-I(+/+) Lung Skeletal_muscle Testis
ConA Amide80 ConA ConA AAL(+) AAL ConA RCA120 ConA ConA ConA
     
   
       
 
   
 
   
           
       
 
 
       
 
 
 
     
     
   
       
                   
                     
                     
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

GeneID InterPro KEGG MGI PIRSF PROSITE Pfam PhosphoSitePlus RefSeq UCSC

26363

IPR003010

IPR012101

mmu:26363

MGI:1347001

PIRSF011861

PS50263

PF00795

Q8CIF4

NP_079571.1

uc007sxy.2

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05