GlycoProtDB ID - GPDB0006712


Protein Name Amiloride-sensitive amine oxidase [copper-containing]
Protein Accession Number Q8JZQ5
Gene Aoc1
Length 751
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
MSLAFGWAAV ILLLQTADTA SAVTTPHDKA RIFADLSPQE IKAVHSFLMS RKELGLESSK NLTLAKNSVF LIEMLLPKKK NVLKFLDEGR KSPVREARAI
IFFGAQDHPN VTEFAVGPLP RPCYVQALSP RPGHHLSWSS RPISTAEYDL LYHMLNRAIT PLHQFFLDTT GFSFLGCDDR FLTFTDVAPR GVESGQRRSW
LIVQRYVEGY FLHPTGLEIL VDHSSTDVQD WRVEQLWYNG KFYNSPEELA QKYAVGEVEA VVLEEVVLED PLPGATEQPP LFSSYKPRGE FHTPVTVAGP
HVVQPSGPRY KLEGNVVLYG DWSFSYRLRS SSGLQIFNVL FGGERVAYEV SVQEAVALYG GHTPAGMQTK YIDVGWGLGS VTHELAPGID CPETATFLDA
FHYYDSDGPV LYPRALCLFE MPTGVPLRRH FDSNFKGGFN FYAGLKGYVL VLRTTSTVYN YDYIWDFIFY PNGVMETKMH ATGYVHATFY TPEGLRHGTR
LQTHLLGNIH THLVHYRVDL DVAGTKNSFR TLKTKLENIT NPWSPSHSLV QPTLEQTQYS HEHQAAFRFG QTLPKYLLFS SPQKNRWGHR RSYRLQIHSM
AEQVLPPGWQ EERAVTWARY PLAVTKYRES ERYSSSLYNQ NDPWDPPVVF EEFLRNNENI ENEDLVAWVT VGFLHIPHSE DVPNTATPGN CVGFLIRPFN
FFEEDPSLAS RDTVIVWPQD NGLNHVQRWI PENRDCLVSP PFSYNGTYKP V

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
61 NLT
110 NVT
538 NIT 536 - 568
LENITNPWSPSHSLVQPTLEQTQYSHEHQAAFR
Shared ( 3 )
745 NGT
Colon
Amide80
 
 
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05