GlycoProtDB ID - GPDB0006789


Protein Name ATP-binding cassette sub-family A member 6
Protein Accession Number Q8K441
Gene Abca6
Length 1624
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
1501
1601
MKELSVHVRQ QTRALLHKIL LKKWRRKRES LLEWSIPIII GLHMGLFSYL ARNIQVLEVP PQDLGSLNEF NGSSLVVVYT PISNITQQIM NKTTFAPTMK
GTRIIGVPSI EDLDEVLLHN IPDALGVIFN DSFSYQLKVL RMYGNPFLKE DLLAHCWDTH SQAFCSLSKY WERGFVALQT AINAGIIEVT TNHSVMEELM
SIDGINMKTL PFIPRDLSDY EIFILFCLLY FSSFIYFASS NVTKERKQCK EVMKVMGLQD SAFWLSWGLI YVGFIFIISI FIAIIITSTQ IIMMTGFLVI
FTLFFLYGLS LIAVTFLMAV LLQKAVLTNL IVLFFTLFWG CVGFTVLHKE LPPSLEWVLS IFSPFAFTSG MAKVIFQDYN LNGVVFPDPS GESYVMIAVF
FILAFDSLLY LVLALYFDKI LLYGAEHRSA PLFFLNPTSC FRKTANRNKV IERDLDPELP SDEYFEPVDP EYQGKEAIRI RNIKKEYKGK SGKVKALKGL
FLDIYESQIT AILGHSGAGK SSLLNILSGL YVPTAGSVTV YNKNLSDMQD LKEIRKAIGV CPQHNVQFDA LTVKENLTLF AKIKGILPQD VEQEVQQILS
ELDMQNIRDD LAEHLSEGQK RKLTFGIATV GDPQILLLDE PTVGLDPFSR QRIWGFLKER RADHVILFST QFMDEADILA DRKVLIANGA LKCTGSSVFL
KRKWGLGYHL SLFMDETCDS ERLTSFINHH IPYAKLKAKT KEKLVYILPL ERTSEFPEFF SDLDKYSGQG LMSYEVSMST LNDVFLNLEG EPSTKQDFEK
RETATDSESL NDMEVAYPSL SQVQETVSTM SLWRMQVCAI ARLRILKLKR ERKAFLIILL LLGIALLPLV IEYVANALLE VKNNWEFKTD LYFLSPGQLP
QGLRTSLLVI NNTESNIEDF LQSLKHQNIV LEVDDFENRN ATNSLSYNGA IIVSGRQKDY RFSAVCNTKR LHCFPILMNV ISNGILHMLN HTQYIRIKED
IFSPFIVLVW TGIQETCLFI LCVICSLSPH IAMSSVSDYK KKADSQLWIS GLYPSAYWCG QAVVDISLFS GMLLTSYFTS YTSKLLNIDM TSEIVFSVIV
LALGCAASLV FLTYVISFVF GKRKKNSTLW SICFLLVIAI TFEKVANGPF NEALVISATM LVPSFALNGL LVVLEMRAYQ YYIEFEEIKH GLSAVDLLLC
LIPYIHTLLF IFVLRCLELK YGKNVVRRDP IFRIAPQSLK AQPNPEEPID EDENVQAERL RTSDALSTPN LDEKPVIIAS CLHKEYAGQK KHCCSRRTRN
MAVRNVSFCV NKGEILGLLG PDGAGKSSSI RMIAGITKPT AGQVELKRLS SAVGHQGDSR AEFGYCPQEN GLWPNLTVKE HLELYAAVKG LRKEDAVVAI
SRLVNALKLH DQLNVQVQNL VAGATRKLCF VLSILGNSPV LILDEPSTGL DVSGKHQVWQ AIQAVVKDNE KGVLLSTHDL AEAEALCDRA AIMVSGRLRC
IGPIQHLKRK FGQDYVLELR VKDVSQEPLV HREILKLFPQ AARQDRCFSL LTYKLPVTDV HPLSQAFHKL EAVKHGFDLE DYSLSQCTLD RVILELSKEQ
ELGTVYEEAD MTLGRKLLPP SDEL

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
71 NGS 53 - 92
NIQVLEVPPQDLGSLNEFNGSSLVVVYTPISNITQQIMNK
Shared ( 2 )
53 - 92
NIQVLEVPPQDLGSLNEFNGSSLVVVYTPISNITQQIMNK
Shared ( 2 )
84 NIT 53 - 92
NIQVLEVPPQDLGSLNEFNGSSLVVVYTPISNITQQIMNK
Shared ( 2 )
53 - 92
NIQVLEVPPQDLGSLNEFNGSSLVVVYTPISNITQQIMNK
Shared ( 2 )
53 - 92
NIQVLEVPPQDLGSLNEFNGSSLVVVYTPISNITQQIMNK
Shared ( 2 )
91 NKT 53 - 92
NIQVLEVPPQDLGSLNEFNGSSLVVVYTPISNITQQIMNK
Shared ( 2 )
53 - 92
NIQVLEVPPQDLGSLNEFNGSSLVVVYTPISNITQQIMNK
Shared ( 2 )
53 - 92
NIQVLEVPPQDLGSLNEFNGSSLVVVYTPISNITQQIMNK
Shared ( 2 )
130 NDS
192 NHS
241 NVT
544 NLS
576 NLT
911 NNT 905 - 925
TSLLVINNTESNIEDFLQSLK
Unique
940 NAT 926 - 956
HQNIVLEVDDFENRNATNSLSYNGAIIVSGR
Unique
990 NHT
1126 NST
1305 NVS
1375 NLT
Heart Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-)
RCA120 RCA120 RCA120
 
   
 
   
   
 
   
   
     
     
     
     
     
 
 
     
     
     
     
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05