GlycoProtDB ID - GPDB0006880


Protein Name ATP-binding cassette sub-family A member 3
Protein Accession Number Q8R420
Gene Abca3
Length 1704
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
1501
1601
1701
MAVLRQLTLL LWKNYTLKKR KVLVTVLELF LPLLFSGILI WLRLKIQSEN VPNATVYPDQ SIQELPLFFS FPPPGGTWEL AYVPSHSDAA RTITETVKRE
FMIKMRVHGF SSEKDFEDYI RYDNHSSSVL AAVVFEHSFN HSQDPLPLAV KYHLRFSYTR RNYMWTQTGN IFLKETEGWH TTSLFPLFPS PGPREPSSPD
GGEPGYIREG FLAMQHAVDK AIMRYHANTS AQQLFQKLMV ITKRFPFPPY ISDPFLIAIQ YQLPLLLMLS FTYTSLTIIR AVVQEKEKKL KEYMRMMGLN
SWLHWSAWFL MFFLFFLIVV SFMTLLFCVK VKKDIAVLSN SDPSLVLAFL LCFAISSISF SFMVSTFFSK ANIAAAVGGF LYFFTYTPYF FVAPRYNWMT
LSQKLLSCLL SNVAMAMGAQ LIGKFEAKGT GIQWRDLLNP VNVDDNFCFG QVLGMLLLDS ALYGLVTWYV EAVFPGQFGV PQPWHFFLMP SYWCGNPRTV
VGKEEEGSDP EKALRNEYFE AEPEDLVAGI KIKHLSKVFQ VGNKDKMGIR DLTLNLYEGQ ITVLLGHNGA GKTTTMSLLT GLFPPTSGHA YIHGYEISQD
MAQIRKSLGL CPQHDVLFDN LTVAEHLYFY AQLKGLSLQK CPEEVKQMLH ILSLEDKRDL RSKFLSGGMK RKLSIGIALI AGSKVLMLDE PTSGMDAVSR
RAIWDLLQQQ KSDRTVLLTT HFMDEADLLG DRIAILAKGE LQCCGSSLFL KQKYGAGYHM TLVKEPHCNP EGISQLVHHH VPNAMLESHA GAELSFILPK
ESTHRFESLF AKLEKKQKEL GIASFGASVT TMEEVFLRVG KLVDTSMDIQ AIQLPALQYQ HERRASDWAL DSNLCGVMDP TNGIGALIEE EEVLVKLNTG
LALHCQQFWA MFLKKAAYSW REWKMVAAQV LVPLTCLTLA LLAIHYTSEI FDDPLLKLSL NEYGRTVVPF SVPGTSRLAQ QLSENLRDML QAERQEPREV
LGDLEEFLVF RASVEGGGFN ERCLVATSFK DRGELTVVTA LFNNQAYHSP ATALAIVDNL LFKLLCGPQA SIEISNYPQP RNTLQVAKDH FNEGRKGFDI
ALNLLIAMAF LASTFSILAV SERAVQAKHV QFVSGVHVAT FWFSALLWDL ISFLVPSLLL LVVFQAFNVH AFTRDGHMAD LLLLLMLYGW AIIPLMYLMS
FFFSAASTAY TRLTIFNILS GIATFIMVTI MRIPAVKLEE LSRTLDHVFL VLPNHCLGMA VSNFYENYET RRYCTSSELA AHYCKKYNIQ YQESFYAWST
PGVGKFVTSM AASGGIYLTL LFLIETNLLW RLRTFICAFR RRWTLAELQN RTSVLPEDQD VAEERSRILV PSLDSMLDTP LIINELSKVY DQRAPLLAVD
RISLAVQKGE CFGLLGFNGA GKTTTFKMLT GEETITSGDA FVGGYSISSD IGKVRQRMGY CPQFDALLDH MTGREMLVMY ARLRGIPERL INACVENTLR
GLLLEPHANK LVKTYSGGNK RKLSTGIALI GEPAVIFLDE PSTGMDPVAR RLLWDTVARA RESGKAIVIT SHSMEECEAL CTRLAIMVQG QFKCLGSPQH
LKSKFGSGYS LQAKVRSEGK QDALEEFKAF VDLTFPGSIL EDEHQDMVHY HLPGCDLSWA KVFGILEKAK EKYGVDDYSV SQISLEQVFL SFAHLQPPTT
EDGR

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
14 NYT
53 NAT
124 NHS 122 - 151
YDNHSSSVLAAVVFEHSFNHSQDPLPLAVK
Shared ( 3 )
140 NHS 122 - 151
YDNHSSSVLAAVVFEHSFNHSQDPLPLAVK
Shared ( 3 )
228 NTS 225 - 237
YHANTSAQQLFQK
Shared ( 4 )
446 NFC
620 NLT
873 NLC
1254 NHC
1350 NRT
1492 NAC
Brain Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung
ConA AAL AAL(+) AAL(+) RCA120 RCA120 ConA
             
             
   
 
   
 
             
             
             
             
             
             
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05