GlycoProtDB ID - GPDB0006964


Protein Name Carboxylesterase 1D
Protein Accession Number Q8VCT4
Gene Ces1d
Length 565
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
MGLYPLIWLS LAACTAWGYP SSPPVVNTVK GKVLGKYVNL EGFTQPVAVF LGVPFAKPPL GSLRFAPPQP AEPWSFVKNT TSYPPMCSQD AVGGQVLSEL
FTNRKENIPL QFSEDCLYLN IYTPADLTKN SRLPVMVWIH GGGLVVGGAS TYDGLALSAH ENVVVVTIQY RLGIWGFFST GDEHSRGNWG HLDQVAALRW
VQDNIANFGG NPGSVTIFGE SAGGFSVSVL VLSPLAKNLF HRAISESGVS LTAALITTDV KPIAGLVATL SGCKTTTSAV MVHCLRQKTE DELLETSLKL
NLFKLDLLGN PKESYPFLPT VIDGVVLPKA PEEILAEKSF STVPYIVGIN KQEFGWIIPT LMGYPLAEGK LDQKTANSLL WKSYPTLKIS ENMIPVVAEK
YLGGTDDLTK KKDLFQDLMA DVVFGVPSVI VSRSHRDAGA STYMYEFEYR PSFVSAMRPK AVIGDHGDEI FSVFGSPFLK DGASEEETNL SKMVMKFWAN
FARNGNPNGG GLPHWPEYDQ KEGYLKIGAS TQAAQRLKDK EVSFWAELRA KESAQRPSHR EHVEL

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
79 NTT 65 - 104
FAPPQPAEPWSFVKNTTSYPPMCSQDAVGGQVLSELFTNR
Unique
79 - 104
NTTSYPPMCSQDAVGGQVLSELFTNR
Unique
79 - 104
NTTSYPPMCSQDAVGGQVLSELFTNR
Unique
79 - 105
NTTSYPPMCSQDAVGGQVLSELFTNRK
Unique
79 - 105
NTTSYPPMCSQDAVGGQVLSELFTNRK
Unique
489 NLS
Colon Heart Kidney Liver Lung Skeletal_muscle Stomach
RCA120 Amide80 ConA ConA ConA ConA ConA RCA120 ConA
     
       
   
     
     
 
     
   
 
   
       
                 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05