GlycoProtDB ID - GPDB0007026


Protein Name ATP-binding cassette sub-family A member 7
Protein Accession Number Q91V24
Gene Abca7
Length 2159
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
1501
1601
1701
1801
1901
2001
2101
MALGTQLMLL LWKNYTYRRR QPIQLLVELL WPLFLFFILV AVRHSHPPLE HHECHFPNKP LPSAGTVPWL QGLVCNVNNS CFQHPTPGEK PGVLSNFKDS
LISRLLADTR TVLGGHSIQD MLDALGKLIP VLRAVGGGAR PQESDQPTSQ GSVTKLLEKI LQRASLDPVL GQAQDSMRKF SDAIRDLAQE LLTLPSLMEL
RALLRRPRGS AGSLELVSEA LCSTKGPSSP GGLSLNWYEA NQLNEFMGPE VAPALPDNSL SPACSEFVGT LDDHPVSRLL WRRLKPLILG KILFAPDTNF
T
RKLMAQVNQ TFEELALLRD LHELWGVLGP QIFNFMNDST NVAMLQRLLD VGGTGQRQQT PRAQKKLEAI KDFLDPSRGG YSWREAHADM GRLAGILGQM
MECVSLDKLE AVPSEEALVS RALELLGERR LWAGIVFLSP EHPLDPSELS SPALSPGHLR FKIRMDIDDV TRTNKIRDKF WDPGPSADPF MDLRYVWGGF
VYLQDLLEQA AVRVLGGGNS RTGLYLQQMP HPCYVDDVFL RVLSRSLPLF LTLAWIYSVA LTVKAVVREK ETRLRETMRA MGLSRAVLWL GWFLSCLGPF
LVSAALLVLV LKLGNILPYS HPVVIFLFLA AFAVATVAQS FLLSAFFSRA NLAAACGGLA YFALYLPYVL CVAWRERLHL GGLLAASLLS PVAFGFGCES
LALLEEQGDG AQWHNLGTGP AEDVFSLAQV SAFLLLDAVI YGLALWYLEA VCPGQYGIPE PWNFPFRRSY WCGPGPPKSS VLAPAPQDPK VLVEEPPLGL
VPGVSIRGLK KHFRGCPQPA LQGLNLDFYE GHITAFLGHN GAGKTTTLSI LSGLFPPSSG SASILGHDVQ TNMAAIRPHL GICPQYNVLF DMLTVEEHVW
FYGRLKGVSA AAMGPERERL IRDVGLTLKR DTQTRHLSGG MQRKLSVAIA FVGGSRVVIM DEPTAGVDPA SRRGIWELLL KYREGRTLIL STHHLDEAEL
LGDRVAMVAG GSLCCCGSPL FLRRHLGCGY YLTLVKSSQS LVTHDAKGDS EDPRREKKSD GNGRTSDTAF TRGTSDKSNQ APAPGAVPIT PSTARILELV
QQHVPGAQLV EDLPHELLLV LPYAGALDGS FAMVFQELDQ QLELLGLTGY GISDTNLEEI FLKVVEDAHR EGGDSRPQLH LRTCTPQPPT GPEASVLENG
ELAPQGLAPN AAQVQGWTLT CQQLRALLHK RFLLARRSRR GLFAQVVLPA LFVGLALFFS LIVPPFGQYP PLQLSPAMYG PQVSFFSEDA PGDPNRMKLL
EALLGEAGLQ EPSMQDKDAR GSECTHSLAC YFTVPEVPPD VASILASGNW TPESPSPACQ CSQPGARRLL PDCPAGAGGP PPPQAVAGLG EVVQNLTGRN
VS
DFLVKTYP SLVRRGLKTK KWVDEVRYGG FSLGGRDPDL PTGHEVVRTL AEIRALLSPQ PGNALDRILN NLTQWALGLD ARNSLKIWFN NKGWHAMVAF
VNRANNGLLH ALLPSGPVRH AHSITTLNHP LNLTKEQLSE ATLIASSVDV LVSICVVFAM SFVPASFTLV LIEERITRAK HLQLVSGLPQ TLYWLGNFLW
DMCNYLVAVC IVVFIFLAFQ QRAYVAPENL PALLLLLLLY GWSITPLMYP ASFFFSVPST AYVVLTCINL FIGINSSMAT FVLELLSDQN LQEVSRILKQ
VFLIFPHFCL GRGLIDMVRN QAMADAFERL GDKQFQSPLR WDIIGKNLLA MMAQGPLFLL ITLLLQHRNR LLPQSKPRLL PPLGEEDEDV AQERERVTKG
ATQGDVLVLR DLTKVYRGQR NPAVDRLCLG IPPGECFGLL GVNGAGKTST FRMVTGDTLP SSGEAVLAGH NVAQERSAAH RSMGYCPQSD AIFDLLTGRE
HLELFARLRG VPEAQVAQTA LSGLVRLGLP SYADRPAGTY SGGNKRKLAT ALALVGDPAV VFLDEPTTGM DPSARRFLWN SLLSVVREGR SVVLTSHSME
ECEALCTRLA IMVNGRFRCL GSSQHLKGRF GAGHTLTLRV PPDQPEPAIA FIRITFPGAE LREVHGSRLR FQLPPGGRCT LTRVFRELAA QGRAHGVEDF
SVSQTTLEEV FLYFSKDQGE EEESSRQEAE EEEVSKPGRQ HPKRVSRFLE DPSSVETMI

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
14 NYT
78 NNS
79 NSC
299 NFT 292 - 303
ILFAPDTNFTRK
Shared ( 5 )
309 NQT
337 NDS
1349 NWT
1395 NLT 1368 - 1399
RLLPDCPAGAGGPPPPQAVAGLGEVVQNLTGR
Shared ( 4 )
1368 - 1407
RLLPDCPAGAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVK
Shared ( 4 )
1369 - 1407
LLPDCPAGAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVK
Shared ( 4 )
1400 NVS 1368 - 1407
RLLPDCPAGAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVK
Shared ( 4 )
1369 - 1407
LLPDCPAGAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVK
Shared ( 4 )
1471 NLT
1532 NLT 1520 - 1535
HAHSITTLNHPLNLTK
Shared ( 4 )
1675 NSS
Brain Colon Heart Liver: b4GalT-I(+/+) Skeletal_muscle Stomach
ConA ConA ConA RCA120 ConA ConA
           
           
           
     
   
           
           
           
         
   
     
   
     
   
     
   
     
           
 
 
           
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05