GlycoProtDB ID - GPDB0007111


Protein Name Adamtsl4 protein
Protein Accession Number Q91YP4
Gene Adamtsl4
Length 235
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
MGPCTTAWFY SDWSSKCSAE CGTGIQRRAV VCLRSGETLQ GDPEAGSTEQ GCPLRSRPPD MRACSLGPCE RTWRWFTGPW SECSSECGSG TQHRDIICVS
KLGAEFNVTS PSNCSHLPRP PALQPCQGQA CEDKWFSTLW SPCSRSCQGG MQTREVQCLS GNQTLSSRCP PHLRPSRKRP CNSQPCNQRP DDQCKDSSPH
CPLVVQARLC VYPYYTTTCC RSCAHVLEQS QLEPA

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
107 NVT 102 - 134
LGAEFNVTSPSNCSHLPRPPALQPCQGQACEDK
Shared ( 2 )
113 NCS 102 - 134
LGAEFNVTSPSNCSHLPRPPALQPCQGQACEDK
Shared ( 2 )
162 NQT 155 - 168
EVQCLSGNQTLSSR
Shared ( 2 )
Heart Kidney Kidney(Fut9 KO) Lung Skeletal_muscle Stomach
ConA RCA120 AAL(+) RCA120 ConA ConA
     
     
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05