GlycoProtDB ID - GPDB0007175


Protein Name Adhesion G protein-coupled receptor L4
Protein Accession Number Q923X1
Gene Adgrl4
Length 739
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
MRLLPLLVGF STLLNCSYTQ NCSKTTCLPN AKCEVHNGVE ACFCSQGYSG NGVTICEDID ECSESSVCGD HAVCENVNGG FSCFCREGYQ TATGKSQFTP
NDGSYCQDID ECSESSVCGD HAVCENVNGG FSCFCREGYQ TATGKSQFTP NDGSYCQESM NSNCHLEHAC IAANINKTLK RIGPITEQTT LLQEIYRNSE
AELSLMDIVT YIEILTESSS LLGHPNSTTS YKDAHFNSTL TEFGETINNF VERSTHKMWD QLPTNHRRLH LTKLMHTAEL VTLQIAQNTQ KNSQFDMNST
DLALKVFAFD STHMKHAHPH MNVDGGYVKI SPRRKAAHGT TGNVVVAFLC YKSIGPLLSS SDNFLLDTQN DNSEGKEKVI SSVISASISS NPPTLYELEK
ITFTLSHVKL SDKHRTQCAF WNYSVDAMNN GSWSTEGCEL THSNDTHTSC RCSHLTHFAI LMSSTSSIGI KDYNILTRIT QLGIIISLIC LAICIFTFWF
FSEIQSTRTT IHKNLCCSLF LAELVFLIGI NINTNKLVCS IIAGLLHYFF LAAFAWMCIE GIHLYLIVVG VIYNKGFLHK NFYIFGYLSP AVVVGFSASL
GYRYYGTTKV CWLSTENNFI WSFIGPACLI ILVNLLAFGV IIYKVFRHTA GLKPEVSCYE NIRSCARGAL ALLFLLGTTW IFGVLHVVHA SVVTAYLFTV
SNAFQGMFIF LFLCVLSRKI QEEYYRLFKN VPCCFGCLR

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
15 NCS
21 NCS
176 NKT 146 - 177
SQFTPNDGSYCQESMNSNCHLEHACIAANINK
Shared ( 2 )
226 NST
237 NST 233 - 253
DAHFNSTLTEFGETINNFVER
Unique
298 NST 292 - 305
NSQFDMNSTDLALK
Unique
422 NYS 414 - 451
HRTQCAFWNYSVDAMNNGSWSTEGCELTHSNDTHTSCR
Unique
430 NGS 414 - 451
HRTQCAFWNYSVDAMNNGSWSTEGCELTHSNDTHTSCR
Unique
444 NDT 414 - 451
HRTQCAFWNYSVDAMNNGSWSTEGCELTHSNDTHTSCR
Unique
514 NLC
Heart Kidney(Fut9 KO) Kidney(Fut9 WT) Stomach
Amide80 ConA AAL(+) AAL(+) ConA
         
         
 
     
         
   
 
 
 
 
   
 
   
 
   
         
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05