GlycoProtDB ID - GPDB0007183


Protein Name Carcinoembryonic antigen-related cell adhesion molecule 2
Protein Accession Number Q925P2
Gene Ceacam2
Length 520
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
MELASAHLHK GQVPWFGLLL TASLLASWSP PTTAQVTVMA FPLHAAEGNN VILVVYNMMK GVSAFSWHKG STTSTNAEIV RFVTGTNKTI KGPVHSGRET
LYSNGSLLIQ RVTMKDTGVY TIEMTDQNYR RRVLTGQFHV HTLLLKSNIT SNNSNPVEGD DSVSLTCDSY TDPDNITYLW SRNGESLSEG DRLKLSEGNR
T
LTLLNVTRN DTGPYVCETR NPVSVNRSDP FSLNIIYGPD TPIISPSDIY LHPGSNLNLS CHAASNPPAQ YFWLINEKPH ASSQELFIPN ITTNNSGTYT
CFVNNSVTGL SRTTVKNITV LEPVTQPSLQ VTNTTVKELD SVTLTCLSKD RQAHIHWIFN NDTLLITEKM TTSQAGLILK IDPIKREDAG EYQCEISNPV
SVKRSNSIKL EVIFDSTYDI SDVPIAVIIT GAVAGVILIA GLAYRLCSRK SRWGSDQRDL TEHKPSASNH NLAPSDNSPN KVDDVAYTVL NFNSQQPNRP
TSAPSSPRAT ETVYSEVKKK

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
87 NKT
104 NGS 99 - 111
ETLYSNGSLLIQR
Shared ( 3 )
148 NIT
152 NNS
175 NIT
199 NRT 195 - 209
LSEGNRTLTLLNVTR
Shared ( 8 )
195 - 220
LSEGNRTLTLLNVTRNDTGPYVCETR
Shared ( 8 )
206 NVT 195 - 209
LSEGNRTLTLLNVTR
Shared ( 8 )
195 - 220
LSEGNRTLTLLNVTRNDTGPYVCETR
Shared ( 8 )
201 - 220
TLTLLNVTRNDTGPYVCETR
Shared ( 8 )
201 - 209
TLTLLNVTR
Shared ( 8 )
201 - 227
TLTLLNVTRNDTGPYVCETRNPVSVNR
Shared ( 8 )
210 NDT 195 - 220
LSEGNRTLTLLNVTRNDTGPYVCETR
Shared ( 8 )
201 - 220
TLTLLNVTRNDTGPYVCETR
Shared ( 8 )
210 - 220
NDTGPYVCETR
Shared ( 8 )
210 - 227
NDTGPYVCETRNPVSVNR
Shared ( 8 )
201 - 227
TLTLLNVTRNDTGPYVCETRNPVSVNR
Shared ( 8 )
226 NRS 210 - 227
NDTGPYVCETRNPVSVNR
Shared ( 8 )
201 - 227
TLTLLNVTRNDTGPYVCETRNPVSVNR
Shared ( 8 )
258 NLS
290 NIT
294 NNS 279 - 312
PHASSQELFIPNITTNNSGTYTCFVNNSVTGLSR
Shared ( 6 )
304 NNS 279 - 312
PHASSQELFIPNITTNNSGTYTCFVNNSVTGLSR
Shared ( 6 )
317 NIT
333 NTT
361 NDT 350 - 369
DRQAHIHWIFNNDTLLITEK
Shared ( 3 )
Colon Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Testis
ConA AAL ConA RCA120 AAL(+) AAL(+) AAL RCA120 SSA RCA120 RCA120 RCA120 ConA ConA
                           
   
                   
                           
                           
                           
                 
     
                 
     
                 
     
                 
     
 
 
             
     
                   
     
                 
     
 
 
                 
     
                 
     
                   
     
                 
     
                   
     
                           
                           
       
                 
       
                 
                           
                           
       
               
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05