GlycoProtDB ID - GPDB0007186


Protein Name CEA-related cell adhesion molecule 1
Protein Accession Number Q925P3
Gene Ceacam1
Length 521
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
MELASAHLHK GQVPWGGLLL TASLLASWSP ATTAEVTIEA VPPQVAEDNN VLLLVHNLPL ALGAFAWYKG NTTAIDKEIA RFVPNSNMNF TGQAYSGREI
IYSNGSLLFQ MITMKDMGVY TLDMTDENYR RTQATVRFHV HPILLKPNIT SNNSNPVEGD DSVSLTCDSY TDPDNINYLW SRNGESLSEG DRLKLSEGNR
T
LTLLNVTRN DTGPYVCETR NPVSVNRSDP FSLNIIYGPD TPIISPSDIY LHPGSNLNLS CHAASNPPAQ YFWLINEKPH ASSQELFIPN ITTNNSGTYT
CFVNNSVTGL SRTTVKNITV LEPVTQPFLQ VTNTTVKELD SVTLTCLSND IGANIQWLFN SQSLQLTERM TLSQNNSILR IDPIKREDAG EYQCEISNPV
SVRRSNSIKL DIIFDPTQGG LSDGAIAGIV IGVVAGVALI AGLAYFLYSR KSGGGSDQRD LTEHKPSASN HNLAPSDNSP NKVDDVAYTV LNFNSQQPNR
PTSAPSSPRA TETVYSEVKK K

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
71 NTT 70 - 81
GNTTAIDKEIAR
Shared ( 10 )
89 NFT 82 - 98
FVPNSNMNFTGQAYSGR
Shared ( 10 )
82 - 98
FVPNSNMNFTGQAYSGR
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
104 NGS 82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
99 - 115
EIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
99 - 115
EIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
148 NIT
152 NNS
199 NRT 195 - 209
LSEGNRTLTLLNVTR
Shared ( 8 )
195 - 220
LSEGNRTLTLLNVTRNDTGPYVCETR
Shared ( 8 )
206 NVT 195 - 209
LSEGNRTLTLLNVTR
Shared ( 8 )
195 - 220
LSEGNRTLTLLNVTRNDTGPYVCETR
Shared ( 8 )
201 - 220
TLTLLNVTRNDTGPYVCETR
Shared ( 8 )
201 - 209
TLTLLNVTR
Shared ( 8 )
201 - 227
TLTLLNVTRNDTGPYVCETRNPVSVNR
Shared ( 8 )
210 NDT 195 - 220
LSEGNRTLTLLNVTRNDTGPYVCETR
Shared ( 8 )
201 - 220
TLTLLNVTRNDTGPYVCETR
Shared ( 8 )
210 - 220
NDTGPYVCETR
Shared ( 8 )
210 - 227
NDTGPYVCETRNPVSVNR
Shared ( 8 )
201 - 227
TLTLLNVTRNDTGPYVCETRNPVSVNR
Shared ( 8 )
226 NRS 210 - 227
NDTGPYVCETRNPVSVNR
Shared ( 8 )
201 - 227
TLTLLNVTRNDTGPYVCETRNPVSVNR
Shared ( 8 )
258 NLS
290 NIT
294 NNS 279 - 312
PHASSQELFIPNITTNNSGTYTCFVNNSVTGLSR
Shared ( 6 )
304 NNS 279 - 312
PHASSQELFIPNITTNNSGTYTCFVNNSVTGLSR
Shared ( 6 )
317 NIT 317 - 337
NITVLEPVTQPFLQVTNTTVK
Shared ( 4 )
313 - 337
TTVKNITVLEPVTQPFLQVTNTTVK
Shared ( 4 )
333 NTT 317 - 337
NITVLEPVTQPFLQVTNTTVK
Shared ( 4 )
313 - 337
TTVKNITVLEPVTQPFLQVTNTTVK
Shared ( 4 )
317 - 337
NITVLEPVTQPFLQVTNTTVK
Shared ( 4 )
375 NNS 370 - 385
MTLSQNNSILRIDPIK
Shared ( 14 )
370 - 385
MTLSQNNSILRIDPIK
Shared ( 14 )
370 - 380
MTLSQNNSILR
Shared ( 14 )
370 - 380
MTLSQNNSILR
Shared ( 14 )
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach
RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120 AAL ConA RCA120 AAL(+) AAL(+) AAL ConA RCA120 SSA WGA RCA120 RCA120 ConA RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120
                       
       
             
 
 
   
 
   
       
   
 
   
 
   
 
           
 
                                                 
           
                                       
         
                                         
         
                                       
     
                                           
         
                                         
 
   
                           
   
 
 
                                                 
           
                                       
         
                                         
           
                   
                 
         
                                       
 
       
                     
               
     
                                           
         
                                         
 
   
                           
   
 
                                                     
                                                     
                                 
               
                                 
               
                                 
               
                                 
               
   
       
 
 
 
 
 
       
                           
 
               
                                   
               
                                 
               
   
       
 
 
 
 
 
       
                                 
               
                                 
               
                                   
               
                                 
               
                                   
               
                                                     
                                                     
                   
                               
                   
                               
     
 
     
           
     
   
             
 
   
 
                     
     
 
     
           
     
   
             
 
   
 
                     
                                   
               
 
   
                                           
 
                                                 
 
 
 
 
       
 
 
       
           
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05