GlycoProtDB ID - GPDB0007263


Protein Name Cannabinoid receptor 1 (Fragment)
Protein Accession Number Q99NU3
Gene Cnr1
Length 331
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
FRGSPFQEKM TAGDNSPLVP AGDTTNITEF YNKSLSSFKE NEDNIQCGEN FMDMECFMIL NPSQQLAIAV LSLTLGTFTV LENLLVLCVI LHSRSLRCRP
SYHFIGSLAV ADLLGSVIFV YSFVDFHVFH RKDSPNVFLF KLGGVTASFT ASVGSLFLTA IDRYISIHRP LAYKRIVTRP KAVVAFCLMW TIAIVIAVLP
LLGWNCKKLQ SVCSDIFPLI DETYLMFWIG VTSVLLLFIV YAYMYILWKA HSHAVRMIQR GTQKSIIIHT SEDGKVQVTR PDQARMDIRL AKTLVLILVV
LIICWGPLLA IMVYDVFGKM NKLIKTVFAF C

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
26 NIT 10 - 33
MTAGDNSPLVPAGDTTNITEFYNK
Shared ( 2 )
10 - 39
MTAGDNSPLVPAGDTTNITEFYNKSLSSFK
Shared ( 2 )
32 NKS 10 - 33
MTAGDNSPLVPAGDTTNITEFYNK
Shared ( 2 )
10 - 39
MTAGDNSPLVPAGDTTNITEFYNKSLSSFK
Shared ( 2 )
Brain
AAL
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05