GlycoProtDB ID - GPDB0007403


Protein Name Calcium-activated chloride channel regulator 1
Protein Accession Number Q9D7Z6
Gene Clca1
Length 913
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
MESLKSPVFL LILHLLEGVL SESLIQLNNN GYEGIVIAID HDVPEDEALI QHIKDMVTQA SPYLFEATGK RFYFKNVAIL IPESWKAKPE YTRPKLETFK
NADVLVSTTS PLGNDEPYTE HIGACGEKGI RIHLTPDFLA GKKLTQYGPQ DRTFVHEWAH FRWGVFNEYN NDEKFYLSKG KPQAVRCSAA ITGKNQVRRC
QGGSCITNGK CVIDRVTGLY KDNCVFVPDP HQNEKASIMF NQNINSVVEF CTEKNHNQEA PNDQNQRCNL RSTWEVIQES EDFKQTTPMT AQPPAPTFSL
LQIGQRIVCL VLDKSGSMLN DDRLNRMNQA SRLFLLQTVE QGSWVGMVTF DSAAYVQSEL KQLNSGADRD LLIKHLPTVS AGGTSICSGL RTAFTVIKKK
YPTDGSEIVL LTDGEDNTIS SCFDLVKQSG AIIHTVALGP AAAKELEQLS KMTGGLQTYS SDQVQNNGLV DAFAALSSGN AAIAQHSIQL ESRGVNLQNN
QWMNGSVIVD SSVGKDTLFL ITWTTHPPTI FIWDPSGVEQ NGFILDTTTK VAYLQVPGTA KVGFWKYSIQ ASSQTLTLTV TSRAASATLP PITVTPVVNK
NTGKFPSPVT VYASIRQGAS PILRASVTAL IESVNGKTVT LELLDNGAGA DATKNDGVYS RFFTAFDANG RYSVKIWALG GVTSDRQRAA PPKNRAMYID
GWIEDGEVRM NPPRPETSYV QDKQLCFSRT SSGGSFVATN VPAAAPIPDL FPPCQITDLK ASIQGQNLVN LTWTAPGDDY DHGRASNYII RMSTSIVDLR
DHFNTSLQVN TTGLIPKEAS SEEIFEFELG GNTFGNGTDI FIAIQAVDKS NLKSEISNIA RVSVFIPAQE PPIPEDSTPP CPDISINSTI PGIHVLKIMW
KWLGEMQVTL GLH

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
504 NGS 494 - 515
GVNLQNNQWMNGSVIVDSSVGK
Unique
770 NLT 761 - 791
ASIQGQNLVNLTWTAPGDDYDHGRASNYIIR
Unique
804 NTS 792 - 817
MSTSIVDLRDHFNTSLQVNTTGLIPK
Unique
792 - 817
MSTSIVDLRDHFNTSLQVNTTGLIPK
Unique
792 - 817
MSTSIVDLRDHFNTSLQVNTTGLIPK
Unique
810 NTT 792 - 817
MSTSIVDLRDHFNTSLQVNTTGLIPK
Unique
792 - 817
MSTSIVDLRDHFNTSLQVNTTGLIPK
Unique
836 NGT
887 NST 862 - 897
VSVFIPAQEPPIPEDSTPPCPDISINSTIPGIHVLK
Unique
Colon Skeletal_muscle Stomach
Amide80 ConA RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120
 
 
   
               
     
         
 
             
 
 
 
             
 
 
                 
           
   
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05