GlycoProtDB ID - GPDB0007545


Protein Name Carboxypeptidase B2
Protein Accession Number Q9JHH6
Gene Cpb2
Length 422
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MKLHGLGILV AIILYEQHGF AFQSGQVLSA LPRTSRQVQL LQNLTTTYEV VLWQPVTAEF IEKKKEVHFF VNASDVDSVK AHLNVSRIPF NVLMNNVEDL
IEQQTFNDTV SPRASASYYE QYHSLNEIYS WIEVITEQHP DMLQKIYIGS SFEKYPLYVL KVSGKEQRIK NAIWIDCGIH AREWISPAFC LWFIGYVTQF
HGKENLYTRL LRHVDFYIMP VMNVDGYDYT WKKNRMWRKN RSAHKNNRCV GTDLNRNFAS KHWCEKGASS SSCSETYCGL YPESEPEVKA VADFLRRNID
HIKAYISMHS YSQQILFPYS YNRSKSKDHE ELSLVASEAV RAIESINKNT RYTHGSGSES LYLAPGGSDD WIYDLGIKYS FTIELRDTGR YGFLLPERYI
KPTCAEALAA ISKIVWHVIR NT

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
43 NLT
72 NAS
84 NVS 81 - 113
AHLNVSRIPFNVLMNNVEDLIEQQTFNDTVSPR
Unique
107 NDT 81 - 113
AHLNVSRIPFNVLMNNVEDLIEQQTFNDTVSPR
Unique
88 - 113
IPFNVLMNNVEDLIEQQTFNDTVSPR
Unique
240 NRS
247 NRC
322 NRS
Colon Heart Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Stomach
Amide80 RCA120 Amide80 ConA RCA120 ConA RCA120 RCA120 Amide80 ConA RCA120
                     
                     
 
 
         
         
                     
                     
                     
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05