GlycoProtDB ID - GPDB0007558


Protein Name Als splice variant 2 (Fragment)
Protein Accession Number Q9JIL0
Gene Als
Length 687
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
GEAWWEPQPL TLPDLPTSSA CLEMAPNVPQ APEKLFFLKP STALPGPSRV HSPHPGQGKG TELRQDWLEC PSGHRFQALE EEAEMWLRQG SPALVVLLAF
WVALGPCYLQ GTDPGASADA EGPQCPVTCT CSYDDYTDEL SVFCSSRNLT QLPDGIPVST RALWLDGNNL SSIPSAAFQN LSSLDFLNLQ GSWLRSLEPQ
ALLGLQNLYH LHLERNLLRS LAAGLFRHTP SLASLSLGNN LLGRLEEGLF RGLSHLWDLN LGWNSLVVLP DTVFQGLGNL HELVLAGNKL TYLQPALLCG
LGELRELDLS RNALRSVKAN VFIHLPRLQK LYLDRNLITA VAPRAFLGMK ALRWLDLSHN RVAGLLEDTF PGLLGLHVLR LAHNAITSLR PRTFKDLHFL
EELQLGHNRI RQLGEKTFEG LGQLEVLTLN DNQIHEVKVG AFFGLFNVAV MNLSGNCLRS LPEHVFQGLG RLHSLHLEHS CLGRIRLHTF AGLSGLRRLF
LRDNSISSIE EQSLAGLSEL LELDLTANQL THLPRQLFQG LGQLEYLLLS NNQLTMLSED VLGPLQRAFW LDLSHNRLET PAEGLFSSLG RLRYLNLRNN
S
LQTFVPQPG LERLWLDANP WDCSCPLKAL RDFALQNPGV VPRFVQTVCE GDDCQPVYTY NNITCAGPAN VSGLDLRDIS ETLFVHC

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
148 NLT
169 NLS
180 NLS
452 NLS
599 NNS 594 - 613
YLNLRNNSLQTFVPQPGLER
Shared ( 5 )
599 - 613
NNSLQTFVPQPGLER
Shared ( 5 )
662 NIT 644 - 677
FVQTVCEGDDCQPVYTYNNITCAGPANVSGLDLR
Shared ( 5 )
644 - 677
FVQTVCEGDDCQPVYTYNNITCAGPANVSGLDLR
Shared ( 5 )
670 NVS 644 - 677
FVQTVCEGDDCQPVYTYNNITCAGPANVSGLDLR
Shared ( 5 )
Liver: b4GalT-I(+/+) Serum
RCA120 Amide80
   
   
   
   
 
 
 
 
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05