GlycoProtDB ID - GPDB0007654


Protein Name Alpha-N-acetylgalactosaminidase
Protein Accession Number Q9QWR8
Gene Naga
Length 415
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MLQKTVLLLA LVAQVLMLEN GLLRTPPMGW LAWERFRCNI DCVEDPKNCI SERLFMEMAD RLAQDGWRDL GYVYLNIDDC WIGGRDASGR LIPDPKRFPH
GIAFLADYAH SLGLKLGIYE DMGKMTCMGY PGTTLDKVEL DAETFAEWKV DMLKLDGCFS SSRERAEGYP KMAAALNATG RPIAFSCSWP AYEGGLPPKV
NYTEVSRVCN LWRNYKDIQD SWKSVLSILD WFVRHQDVLQ PVAGPGHWND PDMLLIGNFG LSFDESRAQM ALWTVLAAPL LMSTDLRTIS PQNMDILQNP
LMIKINQDPL GIQGRRILKS KSHIEVFKRY LSNQASALVF FSRRTDMPFR FHCSLLELNY PKGRVYEGQN VFTGDIFSGL QTEVNFTVII NPSGVVMWYL
YPIKDLGIST MMSHW

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
177 NAT 172 - 207
MAAALNATGRPIAFSCSWPAYEGGLPPKVNYTEVSR
Shared ( 3 )
172 - 207
MAAALNATGRPIAFSCSWPAYEGGLPPKVNYTEVSR
Shared ( 3 )
172 - 199
MAAALNATGRPIAFSCSWPAYEGGLPPK
Shared ( 3 )
201 NYT 172 - 207
MAAALNATGRPIAFSCSWPAYEGGLPPKVNYTEVSR
Shared ( 3 )
172 - 207
MAAALNATGRPIAFSCSWPAYEGGLPPKVNYTEVSR
Shared ( 3 )
200 - 207
VNYTEVSR
Shared ( 3 )
385 NFT
Brain Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Stomach Testis
ConA ConA ConA AAL(+) AAL(+) AAL ConA RCA120 SSA WGA RCA120 RCA120 ConA ConA ConA RCA120
         
                   
 
   
 
               
           
     
         
         
                   
 
   
 
               
 
                               
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05