GlycoProtDB ID - GPDB0007716


Protein Name Cadherin-17
Protein Accession Number Q9R100
Gene Cdh17
Length 827
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
MVSAQLHFLC LLTLYLTCGY GEEGKFSGPL KPMTFSIFEG QEPSQVIFQF KTNPPAVTFE LTGETDGIFK IEKDGLLYHT RALDRETRAV HHLQLAALDS
HGAIVDGPVP ITIEVKDIND NRPTFLQSKY EGSVRQNSRP GKPFMYVNAT DLDDPATPNG QLFYQIVIQL PQINDVMYFQ IDSKTGAISL TPEGSQELDP
VKNPSYNLVV SVKDMGGQSE NSFSDTTYVD ISIRENIWKA PEPVEIRENS TDPHPIKITQ VQWNDPGAQY SLVNKEKLSP FPFSIDQEGN IYVTQALDRE
EKNSHVFFAT AKDENGKPLA YPLEIYVKVI DINDNPPTCL SPVTVFEVQE NEPLGNSIGI FEAHDMDEAN NINSILKYKL VDQTPKVPSD GLFLIGEYEG
KVQLSKQSLK KQDSPQYNLS IEVSDVDFKT LCYIQVNVID INDQIPIFET SNYGSKTLSE DTAIGSTILI IQATDADEPF TGSSKILYKI VQGDTEGRLE
VVTDPTTNAG YVKIKKPLDF ETQPVSSIVF QAENPEPLVK GIEYNASSFA SFELIVTDVN EVPVFPQRIF QANVSEDAAV GSRVGNVTAR DPEGLTVSYS
LKGNMRGWLK IDSVTGEIFS AAPLDRETES VYRVQVVATE VGGSSLSSTA DFHLVLTDVN DNPPRLAKDY TGLFFCHPLS APGSLIFEVT DDDQQSLRRP
KFTFALGREG LQSDWEVSKI NGTHARLSTR HTRFEEQVYN IPIRINDGGQ PPMEGTVFLP VTFCQCVEGS CFRPAGRQDG IPTVGMAVGI LLTTFLVIGI
ILAVVFIRMR KDKVENPQSP ENKPLRS

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
148 NAT
249 NST 240 - 257
APEPVEIRENSTDPHPIK
Shared ( 4 )
418 NLS 411 - 429
KQDSPQYNLSIEVSDVDFK
Shared ( 4 )
545 NAS
573 NVS 569 - 602
IFQANVSEDAAVGSRVGNVTARDPEGLTVSYSLK
Shared ( 4 )
569 - 583
IFQANVSEDAAVGSR
Shared ( 4 )
586 NVT 569 - 602
IFQANVSEDAAVGSRVGNVTARDPEGLTVSYSLK
Shared ( 4 )
584 - 602
VGNVTARDPEGLTVSYSLK
Shared ( 4 )
721 NGT 709 - 726
EGLQSDWEVSKINGTHAR
Shared ( 3 )
Colon Liver Skeletal_muscle
Amide80 RCA120 RCA120 ConA
       
 
 
     
       
     
 
     
     
 
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05