GlycoProtDB ID - GPDB0007756


Protein Name Calcitonin gene-related peptide type 1 receptor
Protein Accession Number Q9R1W5
Gene Calcrl
Length 463
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MDKKHILCFL VLLPLNMALI SAESEEGVNQ TDLGVTRNKI MTAQYECYQK IMQDPIQQAE GLYCNRTWDG WLCWNDVAAG TESMQYCPDY FQDFDPSEKV
TKICDQDGHW FRHPDSNRTW TNYTLCNNST HEKVKTALNL FYLTIIGHGL SIASLIISLI IFFYFKSLSC QRITLHKNLF FSFICNSIVT IIHLTAVANN
QALVATNPVS CKVSQFIHLY LMGCNYFWML CEGVYLHTLI VVAVFAEKQH LMWYYFLGWG FPLLPACIHA IARSLYYNDN CWISSDTHLL YIIHGPICAA
LLVNLFFLLN IVRVLITKLK VTHQVESNLY MKAVRATLIL VPLLGIEFVL FPWRPEGKVA EEVYDYVMHI LMHFQGLLVA TIFCFFNGEV QAILRRNWNQ
YKIQFGNGFS HSDALRSASY TVSTISDMQG YSHDCPTEHL NGKSIQDIEN VALKSENMYD LVM

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
29 NQT
65 NRT 51 - 66
IMQDPIQQAEGLYCNR
Shared ( 2 )
51 - 66
IMQDPIQQAEGLYCNR
Shared ( 2 )
117 NRT 103 - 133
ICDQDGHWFRHPDSNRTWTNYTLCNNSTHEK
Shared ( 2 )
103 - 133
ICDQDGHWFRHPDSNRTWTNYTLCNNSTHEK
Shared ( 2 )
103 - 118
ICDQDGHWFRHPDSNR
Shared ( 2 )
122 NYT 103 - 133
ICDQDGHWFRHPDSNRTWTNYTLCNNSTHEK
Shared ( 2 )
103 - 133
ICDQDGHWFRHPDSNRTWTNYTLCNNSTHEK
Shared ( 2 )
119 - 133
TWTNYTLCNNSTHEK
Shared ( 2 )
119 - 133
TWTNYTLCNNSTHEK
Shared ( 2 )
119 - 135
TWTNYTLCNNSTHEKVK
Shared ( 2 )
119 - 133
TWTNYTLCNNSTHEK
Shared ( 2 )
127 NNS 119 - 133
TWTNYTLCNNSTHEK
Shared ( 2 )
128 NST 103 - 133
ICDQDGHWFRHPDSNRTWTNYTLCNNSTHEK
Shared ( 2 )
119 - 133
TWTNYTLCNNSTHEK
Shared ( 2 )
119 - 135
TWTNYTLCNNSTHEKVK
Shared ( 2 )
Heart Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach
Amide80 ConA AAL ConA RCA120 WGA RCA120 RCA120 ConA Amide80 ConA ConA
                       
     
 
   
             
     
             
       
           
       
       
     
             
       
           
       
 
 
 
 
             
     
               
     
           
       
           
       
             
       
 
 
 
 
               
     
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05