GlycoProtDB ID - GPDB0007785


Protein Name Attractin
Protein Accession Number Q9WU60
Gene Atrn
Length 1428
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
MVAVAAAAAT EARLRGSTTA TAAPAGRKGR QHRPCTATGA WRPGPRARLC LPRVLSRALP PPPLLPLLFS LLLLPLPREA EAAAVAAAVS GSAAAEAKEC
DRPCVNGGRC NPGTGQCVCP TGWVGEQCQH CGGRFRLTGS SGFVTDGPGN YKYKTKCTWL IEGQPNRIMR LRFNHFATEC SWDHLYVYDG DSIYAPLIAA
FSGLIVPERD GNETAPEVTV TSGYALLHFF SDAAYNLTGF NITYNFDMCP NNCSGRGECK SSNSSSAVEC ECSENWKGES CDIPHCTDNC GFPHRGICNA
S
DTRGCSCFP HWQGPGCSIP VPANQSFWTR EEYSDLKLPR ASHKAVVNGN IMWVVGGYMF NHSDYSMVLA YDLTSREWLP LNHSVNSVVV RYGHSLALHK
DKIYMYGGKI DSTGNVTNEL RVFHIHNESW VLLTPKAKDQ YAVVGHSAHI VTLASGRVVM LVIFGHCPLY GYISVVQEYD LEKNTWSILH TQGALVQGGY
GHSSVYDDRT KALYVHGGYK AFSANKYRLA DDLYRYDVDT QMWTILKDSR FFRYLHTAVI VSGTMLVFGG NTHNDTSMSH GAKCFSSDFM AYDIACDRWS
VLPRPELHHD VNRFGHSAVL YNSTMYVFGG FNSLLLSDVL VFTSEQCDAH RSEAACVAAG PGIRCLWDTQ SSRCTSWELA TEEQAEKLKS ECFSKRTLDH
DRCDQHTDCY SCTANTNDCH WCNDHCVPVN HSCTEGQISI AKYESCPKDN PMYYCNKKTS CRSCALDQNC QWEPRNQECI ALPENICGNG WHLVGNSCLK
ITTAKENYDN AKLSCRNHNA FLASLTSQKK VEFVLKQLRL MQSSQSMSKL TLTPWVGLRK INVSYWCWED MSPFTNSLLQ WMPSEPSDAG FCGILSEPST
RGLKAATCIN PLNGSVCERP ANHSAKQCRT PCALRTACGE CTSSSSECMW CSNMKQCVDS NAYVASFPFG QCMEWYTMSS CPPENCSGYC TCSHCLEQPG
CGWCTDPSNT GKGKCIEGSY KGPVKMPSQA SAGNVYPQPL LNSSMCLEDS RYNWSFIHCP ACQCNGHSKC INQSICEKCE DLTTGKHCET CISGFYGDPT
NGGKCQPCKC NGHASLCNTN TGKCFCTTKG VKGDECQLCE VENRYQGNPL KGTCYYTLLI DYQFTFSLSQ EDDRYYTAIN FVATPDEQNR DLDMFINASK
NFNLNITWAT SFPAGTQTGE EVPVVSKTNI KEYKDSFSNE KFDFRNHPNI TFFVYVSNFT WPIKIQIAFS QHSNFMDLVQ FFVTFFSCFL SLLLVAAVVW
KIKQSCWASR RREQLLREMQ QMASRPFASV NVALETDEEP PDLIGGSIKT VPKPIALEPC FGNKAAVLSV FVRLPRGLGG IPPPGQSGLA VASALVDISQ
QMPIVYKEKS GAVRNRKQQP PAQPGTCI

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
212 NET
236 NLT
241 NIT
251 NNC
252 NCS
263 NSS 261 - 277
SSNSSSAVECECSENWK
Shared ( 2 )
299 NAS 296 - 304
GICNASDTR
Shared ( 2 )
278 - 304
GESCDIPHCTDNCGFPHRGICNASDTR
Shared ( 2 )
324 NQS 305 - 337
GCSCFPHWQGPGCSIPVPANQSFWTREEYSDLK
Shared ( 2 )
361 NHS
382 NHS 377 - 391
EWLPLNHSVNSVVVR
Shared ( 3 )
415 NVT 410 - 421
IDSTGNVTNELR
Shared ( 7 )
410 - 436
IDSTGNVTNELRVFHIHNESWVLLTPK
Shared ( 3 )
427 NES 410 - 436
IDSTGNVTNELRVFHIHNESWVLLTPK
Shared ( 3 )
574 NDT
622 NST
717 NDC
730 NHS
785 NIC
796 NSC
862 NVS
913 NGS 905 - 926
AATCINPLNGSVCERPANHSAK
Shared ( 7 )
922 NHS 905 - 926
AATCINPLNGSVCERPANHSAK
Shared ( 7 )
985 NCS
1042 NSS
1053 NWS
1072 NQS 1070 - 1078
CINQSICEK
Shared ( 5 )
1197 NAS 1191 - 1200
DLDMFINASK
Shared ( 3 )
1205 NIT
1249 NIT
1258 NFT
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Skeletal_muscle Stomach
ConA RCA120 ConA RCA120 AAL ConA AAL(+) AAL(+) AAL ConA RCA120 RCA120 RCA120 ConA ConA
                             
                             
                             
                             
                             
                           
           
             
                           
                     
     
                             
                     
     
 
   
     
     
 
                           
                           
                             
                             
                             
                             
                             
                             
                             
 
     
 
 
     
 
                             
                             
                             
         
             
                           
                             
                             
                             
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05