GlycoProtDB ID - GPDB0007831


Protein Name CD97 antigen
Protein Accession Number Q9Z0M6
Gene Cd97
Length 818
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
MRGVRCPGLL VVCILLSLSG AGTQKAESKN CAKWCPINSK CVSNRSCVCK PGFSSEKELI TNPAESCEDI NECLLPGFSC GDFAMCKNSE GSYTCVCNLG
YKLLSGAESF VNESENTCQA SVNTGTTPVP SRIHTVTTAP GNLPEQTTTV HQTQMGDSEE RTPKDVNECI SGQNHCHQST HCINKLGGYS CICRQGWKPV
PGSPNGPVST VCEDVDECSS GQHQCHNSTV CKNTVGSYKC HCRPGWKPTS GSLRGPDTIC QEPPFPTWTL LPTAHSQTLL RFSVEVQNLL RDFNPATVNY
T
IQKLIEAVD KLLEDPMETQ TQQVAAQLLS NLEQSLRTLA QFLPKGPFTY TSPSNTELSL MVKEQDNKDV TTVHHGQTWM ELDWAVTAGA KISENGSSVA
GILSSPNMEK LLGNTPLNLE QRRASLEDFY GSPIPSVSLK LLSNINSVFL TNTNTEKLAS NVTFKFDFTS VESIEPRHEL ICAFWKAHNG NGYWDTDGCS
MNGTGFCHCN HLTSFAILMA QYHVQDPRLE LITKVGLLLS LICLLLCILT FLLVKPIQSS RTMVHLHLCI CLFLGSIIFL VGVENEGGEV GLRCRLVAMM
LHFCFLAAFC WMALEGVELY FLVVRVFQGQ GLSTWQRCLI GYGVPLLIVA ISMAVVKMDG YGHATYCWLD FRKQGFLWSF SGPVAFIIFC NAAIFVITVW
KLTKKFSEIN PNMKKLRKAR VLTITAIAQL LVLGCTWGFG LFLFNPHSTW LSYIFTLLNC LQGLFLYVML CLLNKKVREE YWKWACMVTG SKYTEFNSST
TGTGTSQTRA LRSSESGM

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
44 NRS
71 NEC
112 NES
116 NTC
167 NEC
174 NHC
227 NST 195 - 232
QGWKPVPGSPNGPVSTVCEDVDECSSGQHQCHNSTVCK
Shared ( 4 )
299 NYT 292 - 304
DFNPATVNYTIQK
Shared ( 8 )
395 NGS 392 - 410
ISENGSSVAGILSSPNMEK
Shared ( 8 )
461 NVT
502 NGT
797 NSS
Colon Heart Kidney(Fut9 KO) Kidney(Fut9 WT) Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung
Amide80 Amide80 AAL(+) AAL(+) RCA120 RCA120 ConA
             
             
             
             
             
             
           
 
   
             
             
             
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05