GlycoProtDB ID - GPDB0007866


Protein Name Atrial natriuretic peptide-converting enzyme
Protein Accession Number Q9Z319
Gene Corin
Length 1113
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
1101
MGRVSFSVRV SSVRRARCSC PGRCYLSCRV PPTTALRALN GLGCAGVPGE TAGGAVGPGP LGTRGFLSGS KFQAPGSWKD CFGAPPAPDV LRADRSVGEG
CPQKLVTANL LRFLLLVLIP CICALIVLLA ILLSFVGTLK RVYFKSNDSE PLVTDGEARV PGVIPVNTVY YENTGAPSLP PSQSTPAWTP RAPSPEDQSH
RNTSTCMNIT HSQCQILPYH STLAPLLPIV KNMDMEKFLK FFTYLHRLSC YQHILLFGCS LAFPECVVDG DDRHGLLPCR SFCEAAKEGC ESVLGMVNSS
WPDSLRCSQF RDHTETNSSV RKSCFSLQQE HGKQSLCGGG ESFLCTSGLC VPKKLQCNGY NDCDDWSDEA HCNCSKDLFH CGTGKCLHYS LLCDGYDDCG
DLSDEQNCDC NLTKEHRCGD GRCIAAEWVC DGDHDCVDKS DEVNCSCHSQ GLVECRSGQC IPSTFQCDGD EDCKDGSDEE NCSDSQTPCP EGEQGCLGSS
CVESCAGSSL CDSDSSLSNC SQCEPITLEL CMNLPYNHTH YPNYLGHRTQ KEASISWESS LFPALVQTNC YKYLMFFACT ILVPKCDVNT GQRIPPCRLL
CEHSKERCES VLGIVGLQWP EDTDCNQFPE ESSDNQTCLL PNEDVEECSP SHFKCRSGRC VLGSRRCDGQ ADCDDDSDEE NCGCKERALW ECPFNKQCLK
HTLICDGFPD CPDSMDEKNC SFCQDNELEC ANHECVPRDL WCDGWVDCSD SSDEWGCVTL SKNGNSSSLL TVHKSAKEHH VCADGWRETL SQLACKQMGL
GEPSVTKLIP GQEGQQWLRL YPNWENLNGS TLQELLVYRH SCPSRSEISL LCSKQDCGRR PAARMNKRIL GGRTSRPGRW PWQCSLQSEP SGHICGCVLI
AKKWVLTVAH CFEGREDADV WKVVFGINNL DHPSGFMQTR FVKTILLHPR YSRAVVDYDI SVVELSDDIN ETSYVRPVCL PSPEEYLEPD TYCYITGWGH
MGNKMPFKLQ EGEVRIIPLE QCQSYFDMKT ITNRMICAGY ESGTVDSCMG DSGGPLVCER PGGQWTLFGL TSWGSVCFSK VLGPGVYSNV SYFVGWIERQ
IYIQTFLQKK SQG

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
147 NDS 146 - 159
SNDSEPLVTDGEAR
Shared ( 5 )
202 NTS 192 - 231
APSPEDQSHRNTSTCMNITHSQCQILPYHSTLAPLLPIVK
Shared ( 5 )
208 NIT 192 - 231
APSPEDQSHRNTSTCMNITHSQCQILPYHSTLAPLLPIVK
Shared ( 5 )
298 NSS
317 NSS 307 - 322
CSQFRDHTETNSSVRK
Shared ( 6 )
361 NDC
373 NCS 354 - 376
KLQCNGYNDCDDWSDEAHCNCSK
Shared ( 5 )
355 - 376
LQCNGYNDCDDWSDEAHCNCSK
Shared ( 5 )
411 NLT 386 - 414
CLHYSLLCDGYDDCGDLSDEQNCDCNLTK
Shared ( 4 )
444 NCS 440 - 456
SDEVNCSCHSQGLVECR
Shared ( 4 )
481 NCS
519 NCS
537 NHT
635 NQT
719 NCS 719 - 738
NCSFCQDNELECANHECVPR
Shared ( 6 )
765 NSS 763 - 774
NGNSSSLLTVHK
Shared ( 6 )
828 NGS
970 NET
1089 NVS
Heart Stomach
Amide80 ConA ConA RCA120
 
   
 
   
 
   
       
 
   
       
 
   
 
   
 
   
       
       
       
       
   
 
   
       
       
       
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05